Biochemicals and Reagents

<p>Mouse monoclonal KRT18 antibody</p>

<p>Purified Rabbit polyclonal JNK1/2/3 antibody (Thr183+Tyr185)</p>

<p>Recombinant Human SNAPC1 protein</p>

<p>GPR37 antibody was raised in Rabbit using Human GPR37 as the immunogen</p>

<p>CIRBP antibody was raised using the N terminal of CIRBP corresponding to a region with amino acids MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG</p>

<p>IKZF3 antibody was raised in rabbit using the C terminal of IKZF3 as the immunogen</p>

<p>The MCL1 antibody is a highly specialized monoclonal antibody that targets the growth factor MCL1. It plays a crucial role in regulating cell survival and apoptosis. This antibody specifically binds to MCL1, inhibiting its activity and promoting cell death in cancer cells.</p>

<p>Rabbit polyclonal WRKY71 antibody</p>

<p>Rabbit polyclonal SIGLEC5 antibody</p>

<p>SQSTM1 antibody is a monoclonal antibody that targets the SQSTM1 protein, also known as p62. This protein plays a crucial role in various cellular processes, including hepatocyte growth, TNF-α signaling, collagen degradation, and autophagy. The SQSTM1 antibody specifically binds to the SQSTM1 protein and can be used for various applications in research and diagnostics.</p>

<p>Rabbit polyclonal COL4A2 antibody (HRP)</p>

<p>NT-proBNP antibody was raised in mouse using synthetic N-terminal pro brain natriuretic peptide (NT-proBNP), corresponding to amino acid residues 13-27 as the immunogen.</p>

<p>The IL4 antibody is a monoclonal antibody that targets the β-catenin protein. It has cytotoxic properties and acts as a growth factor inhibitor. This antibody specifically binds to IL4, preventing its interaction with its receptor and inhibiting downstream signaling pathways. Additionally, the IL4 antibody has anti-dnp antibodies, antiangiogenic effects, and interferon neutralizing activity. It can induce apoptosis by activating caspase-9 and has been shown to have potent antitumor effects in various cancer models. The IL4 antibody is widely used in Life Sciences research for studying endothelial growth, immune responses, and cell lysis.</p>

<p>IAA-BSA is a hapten conjugate that is commonly used in Life Sciences research. It is a reactive compound that can be easily attached to an electrode or other surfaces for various applications. IAA-BSA has been widely used in studies related to collagen, monoclonal antibodies, and mitochondrial superoxide. It has shown neutralizing effects on certain monoclonal antibodies and has been found to modulate hepatocyte growth factor signaling pathways. Additionally, IAA-BSA has been used in the study of epidermal growth factor receptor (EGFR) and phosphoinositide 3-kinase (PI3K) signaling pathways. Its acidic nature allows it to bind to various proteins and antigens, making it a valuable tool for researchers in the field of Proteins and Antigens.</p>

<p>Purified recombinant TSSK2 protein (His tag)</p>

<p>Mouse monoclonal MAPK1 antibody</p>

<p>The ID3 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to fibroin, a protein involved in various cellular processes. This monoclonal antibody has been extensively studied and is known for its high specificity and affinity towards fibroin.</p>

<p>The PAI antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the activated tyrosine kinase receptor, which plays a crucial role in cell signaling pathways. By binding to this receptor, the PAI antibody inhibits its activity and prevents the transmission of signals that promote cell growth and proliferation.</p>

<p>MPP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEME</p>

<p>Phytase antibody is a monoclonal antibody that targets and inhibits the activity of phosphatase enzymes. It has been shown to reduce microvessel density and inhibit the growth of blood vessels in tumors. This antibody specifically binds to sclerostin, a protein involved in bone metabolism, and has been found to increase bone mineral density. Additionally, phytase antibody has shown potential as a therapeutic agent for various diseases such as cancer and autoimmune disorders by targeting chemokines, collagen, alpha-fetoprotein, and interleukins. Its cytotoxic effects make it a promising candidate for targeted cancer therapy.</p>

<p>Rabbit polyclonal MAPK9 antibody</p>

<p>Rabbit polyclonal TCF7L2 antibody</p>

<p>Purified Rabbit polyclonal KIF2C antibody</p>

<p>Purified Rabbit polyclonal NCF1 antibody</p>

<p>STAT5B antibody was raised in rabbit using the C terminal of STAT5B as the immunogen</p>

<p>Lamin A+C Monoclonal Antibody (HRP)</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>CXorf66 antibody was raised using the middle region of CXorf66 corresponding to a region with amino acids PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE</p>

<p>Purified recombinant DDX39A protein (His tag)</p>

<p>TRPA1 antibody was raised using the middle region of TRPA1 corresponding to a region with amino acids KCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLAL</p>

<p>GPT2 antibody was raised in Rabbit using Human GPT2 as the immunogen</p>

<p>Purified recombinant SSX1 protein (His tag)</p>

<p>TMED10 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF</p>

<p>PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE</p>

<p>Purified native Pig Troponin I protein (Skeletal Muscle)</p>

<p>Mouse monoclonal PRKCE antibody</p>

<p>The HSP40 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to Heat Shock Protein 40 (HSP40), a protein involved in cellular processes such as protein folding and transportation. This antibody recognizes the amino group of HSP40 and can be used for various applications, including immunohistochemistry, Western blotting, and ELISA.</p>

<p>MGMT antibody was raised in Rabbit using Human MGMT as the immunogen</p>

<p>Rat monoclonal CD45RB antibody (PE)</p>

<p>Mouse monoclonal SORD antibody</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>The Yellow Fever Virus NS1 protein is a key component in the study of yellow fever virus and its effects on the human body. It has been found to have anti-glial fibrillary acidic properties, meaning it can inhibit the growth of glial cells in the brain. Additionally, it has been shown to interact with various receptors and factors in the body, such as the growth hormone receptor and interleukin-6 inhibitory factor. This protein is often used in research and scientific studies related to yellow fever virus, as well as in the development of diagnostic tests and therapies. Monoclonal antibodies targeting this protein have been developed for use in neutralizing the virus and detecting its presence in human serum. Recombinant forms of this protein are also used for various applications in Life Sciences, including conjugated proteins for specific assays. Overall, the Yellow Fever Virus NS1 protein is a crucial tool for understanding and combating yellow fever virus infections.</p>

<p>Mouse RBC antibody was raised in rabbit using murine erythrocytes as the immunogen.</p>

<p>The FGFR1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the growth factor receptor FGFR1, which plays a crucial role in cell growth and proliferation. By blocking the activation of FGFR1, this antibody prevents the downstream signaling pathways that promote cell division.</p>

<p>RBM26 antibody was raised using the middle region of RBM26 corresponding to a region with amino acids PAALKAAQKTLLVSTSAVDNNEAQKKKQEALKLQQDVRKRKQEILEKHIE</p>

<p>Rabbit polyclonal SYT4 antibody</p>

<p>Purified Rabbit polyclonal MOT12 antibody</p>

<p>Rabbit polyclonal MEF2D antibody (Ser444)</p>

<p>The SRR antibody is a monoclonal antibody that is specifically designed for the detection and neutralization of insulin. It is commonly used in research and clinical settings to study hyperinsulinaemic hypoglycaemia, a condition characterized by abnormally high levels of insulin in the blood. The SRR antibody is produced through chemical synthesis or recombinant technology using human insulin as the antigen. It has been extensively validated using techniques such as polymerase chain reaction (PCR) and racemase assays to ensure its specificity and reliability. This monoclonal antibody can be used to detect insulin in various samples, including serum, plasma, and tissue extracts. Additionally, it has been shown to have neutralizing activity against insulin, making it a valuable tool for studying the effects of insulin antibodies and autoantibodies in human insulin preparations. With its high affinity for insulin and ability to recognize specific amino acid residues, the SRR antibody offers precise and accurate results for insulin-related research applications.</p>

<p>The Cry1 antibody is a highly specialized antibody used in Life Sciences research. It specifically targets and binds to the Cry1 protein, which is involved in various cellular processes such as tyrosine phosphorylation and growth factor signaling. This antibody is colloidal gold-conjugated, making it easily detectable in experiments using techniques such as immunohistochemistry or Western blotting.</p>