Biochemicals and Reagents

<p>Rabbit polyclonal Raf1 antibody (Ser259)</p>

<p>Rabbit polyclonal DAPP1 antibody (Tyr139)</p>

<p>FBG2 antibody was raised in rabbit using residues 268-284 (SEAQPGQKHGQEEAAQS) of the human FBG2 protein as the immunogen.</p>

<p>UBE2C antibody was raised using the middle region of UBE2C corresponding to a region with amino acids QGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNP</p>

<p>IKZF3 antibody was raised in Rabbit using Human IKZF3 as the immunogen</p>

<p>Purified Polyclonal GNL1 antibody</p>

<p>Mouse anti Human IgG4 pFC antibody - HRP conjugate</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EVX2 antibody, catalog no. 70R-9601</p>

<p>Rabbit polyclonal SLC19A3 antibody</p>

<p>Rabbit polyclonal OLFML2B antibody</p>

<p>Triiodothyronine antibody was raised in mouse using triiodothyronine-BSA as the immunogen.</p>

<p>Rabbit polyclonal PDGFRa antibody (Tyr849)</p>

<p>MKL1 antibody was raised in rabbit using the C terminal of MKL1 as the immunogen</p>

<p>The Collagen Type IV antibody is a powerful tool in the field of Life Sciences. Produced by hybridoma cells, this antibody specifically targets collagen, a vital component of connective tissues. It has been shown to have inhibitory effects on helicobacter growth and can be used to detect autoantibodies in various diseases. Additionally, the Collagen Type IV antibody can be utilized as a substrate for siRNA delivery or as an anti-connexin agent. With its high specificity and affinity, this monoclonal antibody is widely used in research laboratories for studying endothelial growth and the role of collagen in various biological processes.</p>

<p>TNFSF12 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to the TNFSF12 molecule, which is involved in various biological processes such as cell growth, differentiation, and immune response. This antibody has been extensively studied and shown to effectively block the activity of TNFSF12, thereby modulating its downstream effects.</p>

<p>Rabbit polyclonal CBX6 antibody</p>

<p>BMP7 antibody was raised in rabbit using highly pure recombinant human BMP-7 as the immunogen.</p>

<p>Purified Polyclonal GUCY1B3 antibody</p>

<p>Mouse anti-goat IgG (H + L) (HRP) was raised in mouse using goat IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit polyclonal GPR27 antibody</p>

<p>RNF139 antibody was raised using the N terminal of RNF139 corresponding to a region with amino acids SQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPR</p>

<p>The Elastin antibody is a neutralizing inhibitor that is widely used in Life Sciences research. It specifically targets protein kinases involved in the regulation of TGF-beta signaling pathway, P2X receptors, and collagen synthesis. This antibody has been shown to effectively block the activation of these proteins, preventing the downstream effects such as proton release, superoxide production, and chemokine secretion. Additionally, the Elastin antibody is commonly used for immunohistochemistry and immunofluorescence experiments to detect elastin expression in various tissues and cell types. It is a polyclonal antibody derived from animals and exhibits high specificity and sensitivity. Researchers often rely on this antibody to study the role of elastin in various biological processes and its potential as a therapeutic target for conditions related to mesenchymal stem cells dysfunction.</p>

<p>GCOM1 antibody was raised using the middle region of Gcom1 corresponding to a region with amino acids VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK</p>

<p>Purified Rabbit polyclonal CD32 antibody (Tyr292)</p>

<p>Soporidine is an inhibitor of protein interactions, which is used in the study of receptor-ligand interactions. Soporidine has been shown to activate some receptors and inhibit others. It has also been shown to be a potent inhibitor of ion channels and may be useful as a research tool for studying ion channel function.</p>

<p>RTCD1 antibody was raised using the N terminal of RTCD1 corresponding to a region with amino acids VQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIK</p>

<p>Rabbit polyclonal alpha Synuclein antibody (Tyr136)</p>

<p>Mouse monoclonal EPSP synthase antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL8 antibody, catalog no. 70R-8348</p>

<p>NANP antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>CXorf66 antibody was raised using the middle region of CXorf66 corresponding to a region with amino acids PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE</p>

<p>Purified recombinant DDX39A protein (His tag)</p>

<p>TRPA1 antibody was raised using the middle region of TRPA1 corresponding to a region with amino acids KCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLAL</p>

<p>GPT2 antibody was raised in Rabbit using Human GPT2 as the immunogen</p>

<p>Purified recombinant SSX1 protein (His tag)</p>

<p>TMED10 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF</p>

<p>PSMA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE</p>

<p>Purified native Pig Troponin I protein (Skeletal Muscle)</p>

<p>Mouse monoclonal PRKCE antibody</p>

<p>The HSP40 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to Heat Shock Protein 40 (HSP40), a protein involved in cellular processes such as protein folding and transportation. This antibody recognizes the amino group of HSP40 and can be used for various applications, including immunohistochemistry, Western blotting, and ELISA.</p>

<p>MGMT antibody was raised in Rabbit using Human MGMT as the immunogen</p>

<p>Rat monoclonal CD45RB antibody (PE)</p>

<p>Mouse monoclonal SORD antibody</p>

<p>Mouse monoclonal METTL21A antibody</p>

<p>The Yellow Fever Virus NS1 protein is a key component in the study of yellow fever virus and its effects on the human body. It has been found to have anti-glial fibrillary acidic properties, meaning it can inhibit the growth of glial cells in the brain. Additionally, it has been shown to interact with various receptors and factors in the body, such as the growth hormone receptor and interleukin-6 inhibitory factor. This protein is often used in research and scientific studies related to yellow fever virus, as well as in the development of diagnostic tests and therapies. Monoclonal antibodies targeting this protein have been developed for use in neutralizing the virus and detecting its presence in human serum. Recombinant forms of this protein are also used for various applications in Life Sciences, including conjugated proteins for specific assays. Overall, the Yellow Fever Virus NS1 protein is a crucial tool for understanding and combating yellow fever virus infections.</p>

<p>Mouse RBC antibody was raised in rabbit using murine erythrocytes as the immunogen.</p>

<p>The FGFR1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the growth factor receptor FGFR1, which plays a crucial role in cell growth and proliferation. By blocking the activation of FGFR1, this antibody prevents the downstream signaling pathways that promote cell division.</p>

<p>RBM26 antibody was raised using the middle region of RBM26 corresponding to a region with amino acids PAALKAAQKTLLVSTSAVDNNEAQKKKQEALKLQQDVRKRKQEILEKHIE</p>

<p>Rabbit polyclonal SYT4 antibody</p>