Biochemicals and Reagents

TLE4 antibody was raised in rabbit using the N terminal of TLE4 as the immunogen

ACTR5 antibody was raised in Rabbit using Human ACTR5 as the immunogen

Rabbit polyclonal Histone H2Ax antibody (FITC)

Recombinant human BDH1 protein (His tag)

Conjugated Ketamine BSA

L-type calcium channel blocker

Purified Polyclonal Carboxypeptidase A1 antibody

Rabbit polyclonal MEF2A antibody (Thr319)

Goat anti-rabbit IgG was raised in goat using rabbit IgG F(c) fragment as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B14 antibody, catalog no. 70R-4707

Purified recombinant Human NUDT1 protein

A synthetic peptide for use as a blocking control in assays to test for specificity of CLDN18 antibody, catalog no. 70R-6931

LOXL1 antibody was raised using the middle region of LOXL1 corresponding to a region with amino acids YRPNQNGRGLPDLVPDPNYVQASTYVQRAHLYSLRCAAEEKCLASTAYAP

The IRS1 antibody is a highly effective tool in Life Sciences research. It belongs to the category of Polyclonal Antibodies and is widely used in studies involving growth factors, neurotrophic factors, c-myc, anti-VEGF, epidermal growth factors, and more. This monoclonal antibody specifically targets tyrosine residues on the IRS1 protein, which plays a crucial role in insulin signaling pathways. By binding to IRS1, this antibody can effectively block its activation and downstream signaling events.

TLK117 is a potent inhibitor of kinase, a protein that plays a crucial role in cancer cell growth and proliferation. This human oxytocin analog has been shown to induce apoptosis, or programmed cell death, in tumor cells. TLK117 is an anticancer drug that has demonstrated significant efficacy against various types of cancer in preclinical studies. It is particularly effective against Chinese hamster ovary cells and caffeine-treated urine cells. TLK117 works by inhibiting the activity of kinase, which leads to the suppression of cancer cell growth and proliferation. This inhibitor shows great promise as a novel therapeutic option for the treatment of cancer.

Rabbit polyclonal Rhombotin 1 antibody (FITC)

The FZD8 antibody is a highly specialized antibody that targets the epidermal growth factor receptor. This antibody is designed to specifically bind to FZD8, a protein involved in the Wnt signaling pathway. By binding to FZD8, the antibody inhibits the activation of β-catenin and downstream signaling events, ultimately leading to a decrease in cell proliferation and growth.

MEIS3 antibody was raised in rabbit using the middle region of MEIS3 as the immunogen

The p16 INK4a antibody is a specific antibody used in Life Sciences research. It is a polyclonal antibody that targets the cyclin-dependent kinase inhibitor p16 INK4a. This antibody specifically recognizes and binds to the conformational epitope of p16 INK4a, allowing for accurate detection and quantification of this protein in various biological samples. The p16 INK4a antibody has been widely used in studies investigating cell cycle regulation, tumor suppression, and epidermal growth factor signaling pathways. Its high specificity and sensitivity make it a valuable tool for researchers studying the role of p16 INK4a in cellular processes and disease development.

HIV1 p24 antibody was raised in mouse using HIV1 p24 (native antigen) as the immunogen.

The PAPPA antibody is a cytotoxic monoclonal antibody that is used in immunoassays to detect and neutralize the activity of pregnancy-associated plasma protein A (PAPPA). PAPPA is an enzyme that cleaves insulin-like growth factor-binding proteins (IGFBPs), thereby releasing insulin-like growth factors (IGFs) and promoting cell proliferation. The PAPPA antibody specifically binds to PAPPA, preventing its interaction with IGFBPs and inhibiting its enzymatic activity. This antibody can be used in research and diagnostic applications to study the role of PAPPA in various biological processes, including fetal development, cancer progression, and cardiovascular diseases. With its high specificity and affinity for PAPPA, the monoclonal antibody provides reliable results in experiments involving the detection and quantification of this important biomarker.

The LIN28 antibody is a protein molecular inhibitor that targets the fatty acid transporter. It is a monoclonal antibody used in life sciences research and as a reagent for immunohistochemistry. This antibody specifically inhibits glutaminase, an enzyme involved in the metabolism of glutamine. By blocking the activity of glutaminase, the LIN28 antibody may have potential therapeutic applications as a chemotherapeutic agent. Its high specificity and affinity make it an ideal tool for studying the role of glutaminase in various cellular processes and diseases.

The RAC1 antibody is a highly specialized product used in Life Sciences research. It is an essential tool for studying various cellular processes, including adipose tissue development and human serum analysis. This antibody specifically targets the RAC1 protein, which plays a crucial role in cell signaling and cytoskeletal rearrangement.

Purified Polyclonal Cullin 3 antibody

EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD

The ALOXE3 antibody is a highly specialized antibody that targets the protein mesothelin. Mesothelin is a chemokine that plays a crucial role in various biological processes, including cell growth and migration. This antibody can be used in different research applications, such as immunohistochemistry and western blotting, to detect and quantify mesothelin levels in human serum or tissue samples.

Purified Polyclonal MED30 antibody

Mouse monoclonal SLC7A8 antibody

Lysozyme antibody was raised in mouse using human lysozyme as the immunogen.

The Tau antibody is a highly specialized growth factor that plays a crucial role in various biological processes. It has the ability to interact with interferons and histidine residues, making it an essential component in immune responses. This antibody is produced through advanced techniques using hybridoma cells, ensuring its purity and effectiveness.

Purified recombinant IL34 protein (His tag)

CD47 antibody was raised in Rabbit using Human CD47 as the immunogen

The Tyrosinase antibody is an activated antibody that specifically targets tyrosinase, an enzyme involved in melanin synthesis. This monoclonal antibody is widely used in Life Sciences research and diagnostics. It can be used to detect and quantify tyrosinase levels in various samples, including tissues, cells, and body fluids. The Tyrosinase antibody can also be conjugated with enzymes such as alkaline phosphatases for detection purposes. In addition, this antibody has been used to study the role of tyrosinase in insulin-like growth factor signaling pathways and glycosylation processes. It is a valuable tool for researchers studying melanoma, skin pigmentation disorders, and other related fields.

Mouse monoclonal GIPC antibody

POLR3H antibody was raised using the middle region of POLR3H corresponding to a region with amino acids AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL

SPATA7 antibody was raised using the middle region of SPATA7 corresponding to a region with amino acids FLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMN

ELOVL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK

Mouse monoclonal UCK1 antibody

Sulphamerazine Conjugate for use in immunoassays

The Caspase 9 antibody is a highly specialized product used in Life Sciences research. It is an essential tool for studying apoptosis, or programmed cell death. This antibody specifically targets caspase-9, a key enzyme involved in the apoptotic pathway.

HEXDC antibody was raised using a synthetic peptide corresponding to a region with amino acids CQMAWAIRAHVGVVPSGPAVSCPHSVPEGPGQPLGERLENTEGSSTGRPA

Goat anti-bovine IgG was raised in goat using bovine IgG F(ab')2 fragment as the immunogen.

Purified recombinant Human ARL2BP protein

TCP10L antibody was raised using a synthetic peptide corresponding to a region with amino acids  ASPHAGQESHTLALEPAFGKISPLSADEETIPKYAGHKNQSATLLGQRSS

ZNF681 antibody was raised in rabbit using the N terminal of ZNF681 as the immunogen