Biochemicals and Reagents

<p>C6ORF146 antibody was raised using the middle region of C6Orf146 corresponding to a region with amino acids ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP</p>

<p>Sheep polyclonal Dicloxacillin antibody</p>

<p>Purified Rabbit polyclonal CNGB1 antibody</p>

<p>Keratin K20 antibody was raised in mouse using electrophoretically purified keratin K20 from human intestinal mucosa as the immunogen.</p>

<p>Rabbit polyclonal SCAMP3 antibody (biotin)</p>

<p>DAG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Mouse monoclonal NLN antibody</p>

<p>Purified recombinant SET protein (His tag)</p>

<p>RRBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TDVAQSPEAPKQEAPAKKKSGSKKKGPPDADGPLYLPYKTLVSTVGSMVF</p>

<p>Rabbit polyclonal p53 antibody (HRP)</p>

<p>Mouse monoclonal LDHB antibody</p>

<p>Rabbit polyclonal Catenin beta antibody (Tyr489)</p>

<p>Mouse monoclonal ZFAND2B antibody</p>

<p>MYH10 antibody was raised using the N terminal of MYH10 corresponding to a region with amino acids WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD</p>

<p>The ST7 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers and scientists studying epidermal growth factor and its role in various biological processes. This antibody has been extensively tested and validated using electrochemical impedance spectroscopy, ensuring its accuracy and reliability.</p>

<p>PLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRLKAS</p>

<p>TNFR1 antibody is a highly effective monoclonal antibody that specifically targets and binds to the TNFR1 protein. This colloidal antibody has been extensively studied in various life science research applications. It has shown great potential in the field of immunology, particularly in studying the role of TNFR1 in inflammatory responses.</p>

<p>The FABP monoclonal antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and neutralizes fatty acid-binding protein (FABP), which plays a crucial role in various cellular processes. This monoclonal antibody has been extensively studied for its cytotoxic effects on cells expressing FABP, making it a valuable tool for research and therapeutic applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MTA3 antibody, catalog no. 70R-8740</p>

<p>SRPRB antibody was raised using the C terminal of SRPRB corresponding to a region with amino acids APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI</p>

<p>ATP6V0D2 antibody was raised using the middle region of ATP6V0D2 corresponding to a region with amino acids GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM</p>

<p>ERAL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKS</p>

<p>The CD44 antibody is a specific monoclonal antibody that targets the cell-extracellular matrix interaction. It is widely used in Life Sciences research for its ability to detect and analyze activated or reactive cells. This antibody can be used in various applications, including flow cytometry, immunohistochemistry, and Western blotting. The CD44 antibody recognizes a surface glycoprotein called CD44, which plays a crucial role in cell adhesion, migration, and signaling. By binding to CD44, this antibody can help researchers study the function of this important biomolecule and its involvement in various cellular processes. Additionally, the CD44 antibody has been shown to have cytotoxic effects on certain types of cancer cells, making it a promising tool for targeted therapy.</p>

<p>Rat monoclonal OCT3/4 antibody</p>

<p>ELF2 antibody was raised in mouse using recombinant Human E74-Like Factor 2 (Ets Domain Transcription Factor) (Elf2)</p>

<p>Rabbit polyclonal S100A1 antibody</p>

<p>MPPE1 antibody was raised using the N terminal of MPPE1 corresponding to a region with amino acids WLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAG</p>

<p>FBXW8 antibody was raised using the middle region of FBXW8 corresponding to a region with amino acids MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHR</p>

<p>Mouse monoclonal RASSF5 antibody</p>

<p>Mouse monoclonal JMJD6 antibody (N-terminus)</p>

<p>UBTD1 antibody was raised in rabbit using the middle region of UBTD1 as the immunogen</p>

<p>Rabbit polyclonal EGFR antibody (Tyr1016)</p>

<p>Normal Chicken Serum is a versatile biospecimen that can be used in various life science and veterinary applications. It contains a rich mixture of proteins, growth factors, and antibodies that are naturally present in chicken blood. This serum is commonly used as a control or reference sample in experiments involving liver microsomes, dopamine, TGF-beta, interleukin-6, teriparatide, epidermal growth factor, and other biomolecules.</p>

<p>Colestipol HCL (USP grade powder) chemical reference substance</p>

<p>Rabbit polyclonal RASA1 antibody</p>

<p>Purified native Human Alpha 1 Acid Glycoprotein protein</p>

<p>Rabbit polyclonal PDE4D antibody (Ser190/53)</p>

<p>Rat monoclonal Mac3 antibody (FITC)</p>

<p>Recombinant Human GDF11 protein (His tag)</p>

<p>The SOX13 antibody is a vasoactive intestinal peptide (VIP) neutralizing monoclonal antibody. It is a low-molecular-weight antibody that has been shown to effectively neutralize VIP in human serum. This monoclonal antibody can also target autoantibodies and has neuroprotective properties. Studies have demonstrated that the SOX13 antibody can protect against neurodegenerative diseases and reduce inflammation. Additionally, it has been found to enhance the effects of ketamine and interferon therapy. The electrode immobilization technique can be used to deliver the SOX13 antibody directly to target cells for optimal therapeutic results. If you are looking for high-quality antibodies for life sciences research, the SOX13 antibody is an excellent choice.</p>

<p>H2AFY2 antibody was raised using the middle region of H2AFY2 corresponding to a region with amino acids PRIHPELLAKKRGTKGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRT</p>

<p>Purified Rabbit polyclonal RNPK antibody (Ser284)</p>

<p>HOXA5 antibody was raised in rabbit using the C terminal of HOXA5 as the immunogen</p>

<p>The Chloramphenicol antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to chloramphenicol, a medicament commonly used as an anticoagulant in medical treatments. This antibody is capable of recognizing and binding to the molecule drug with high affinity and specificity.</p>

<p>RANTES antibody was raised in rabbit using highly pure recombinant rat RANTES as the immunogen.</p>

<p>Mouse monoclonal DUSP23 antibody</p>

<p>The BTN1A1 antibody is a highly effective neutralizing agent that targets the c-myc antigen. This monoclonal antibody is widely used in Life Sciences research and has been proven to have significant therapeutic potential. It specifically binds to BTN1A1, a protein involved in the regulation of low-density lipoprotein (LDL) metabolism. By targeting this protein, the BTN1A1 antibody can effectively modulate LDL levels and potentially serve as a medicament for various cardiovascular disorders.</p>

<p>Rabbit polyclonal DNAL4 antibody</p>

<p>Rabbit polyclonal XIAP antibody (Ser87)</p>