Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(100,866 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,368 products)
Found 130563 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
RAF1 antibody
The RAF1 antibody is a highly specific and activated monoclonal antibody that is used in various applications within the field of Life Sciences. This antibody specifically targets RAF1, a protein involved in the mitogen-activated protein kinase (MAPK) signaling pathway. It has been extensively tested and validated for its use in research studies.
NR0B1 antibody
NR0B1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%TFAP2A antibody
TFAP2A antibody was raised in mouse using recombinant Transcription Factor Ap-2 Alpha (Activating Enhancer Binding Protein 2 Alpha)PCBP2 antibody
PCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQHSPA9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HSPA9 antibody, catalog no. 70R-7827Purity:Min. 95%Aurora A antibody
The Aurora A antibody is a polyclonal antibody commonly used in life sciences research. It specifically targets the Aurora A protein, which plays a crucial role in cell division and is highly expressed in human hepatocytes. By binding to Aurora A, this antibody can modulate its activity and inhibit cell proliferation.Purity:Min. 95%FKBP5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FKBP5 antibody, catalog no. 70R-2377Purity:Min. 95%PDAP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PDAP1 antibody, catalog no. 70R-3040Purity:Min. 95%Aurora B Antibody
The Aurora B Antibody is a growth factor that belongs to the class of antibodies. It interacts with calmodulin and plays a crucial role in various cellular processes. This antibody has been shown to be reactive and activated in adipose tissue. It is buffered to maintain stability and effectiveness. The Aurora B Antibody is also neutralizing, meaning it can block the activity of certain proteins or molecules. It is commonly used in Life Sciences research for its immunosuppressant properties. Additionally, this antibody has been found to inhibit the activity of 3-kinase, which is involved in cell signaling pathways. It does not have any diuretic effects or interact with influenza hemagglutinin.Purity:Min. 95%HSD17B14 antibody
HSD17B14 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD
TNFRSF11A protein
TNFRSF11A protein is a glycerin-based product that is commonly used in the Life Sciences field. It plays a crucial role in hematopoiesis, the formation of blood cells. Additionally, TNFRSF11A protein has been found to be involved in choroidal neovascularization, a condition characterized by the growth of abnormal blood vessels in the choroid layer of the eye.Purity:Min. 95%FZD4 antibody
The FZD4 antibody is a protein that plays a crucial role in the TGF-beta signaling pathway. It belongs to the family of Polyclonal Antibodies and Monoclonal Antibodies, which are widely used in various fields of Life Sciences research. This antibody specifically targets FZD4, a receptor for Wnt proteins, and can be used for the detection and quantification of FZD4 expression in different tissues and cell types.EMR3 antibody
EMR3 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%Rabbit anti Goat IgG (HRP)
Rabbit anti-goat IgG (HRP) was raised in rabbit using goat IgG F(c) fragment as the immunogen.Purity:Min. 95%SURF4 antibody
SURF4 antibody was raised using the N terminal of SURF4 corresponding to a region with amino acids GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQPurity:Min. 95%PDE1C antibody
PDE1C antibody was raised using the N terminal of PDE1C corresponding to a region with amino acids DLKKNIEYAASVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLASTHMX2 antibody
HMX2 antibody was raised in rabbit using the middle region of HMX2 as the immunogenPurity:Min. 95%VAV2 antibody
The VAV2 antibody is a powerful tool for researchers studying the effects of oncostatin and its inhibitors. This polyclonal antibody specifically targets acidic peptides and has been shown to have neutralizing effects on TGF-beta. It can be used in various applications, including immunohistochemistry, western blotting, and ELISA. The VAV2 antibody has been validated for use in multiple species, making it versatile for different experimental models. Researchers can rely on this monoclonal antibody to accurately detect and measure the levels of VAV2 in samples such as liver microsomes and nuclear extracts. With its high specificity and sensitivity, the VAV2 antibody is an essential tool for investigating the role of VAV2 in various cellular processes, including collagen synthesis, β-catenin signaling, dopamine regulation, and growth factor pathways.CIC antibody
The CIC antibody is a polyclonal antibody that targets the adeno-associated virus (AAV) and inhibits its growth. It is used in research and pharmaceutical preparations to study the role of AAV in various diseases and conditions. This antibody has cytotoxic effects on mesenchymal stem cells, leading to their activation and differentiation. Additionally, the CIC antibody has been shown to modulate the β-catenin pathway, leading to caspase-9 activation and cholinergic signaling. It can be used as a formation inhibitor for protein kinases and is commonly used in polymerase chain reactions (PCR). The CIC antibody is available as a monoclonal antibody for specific targeting and detection purposes.
IFT88 antibody
IFT88 antibody was raised in rabbit using the middle region of IFT88 as the immunogenPurity:Min. 95%PBK Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PBK antibody, catalog no. 70R-5572Purity:Min. 95%c-Jun antibody
The c-Jun antibody is a powerful tool for researchers in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, providing options for various experimental needs. This antibody specifically targets c-Jun, a protein involved in cellular growth and development. It has been extensively studied in relation to helicobacter infection, collagen synthesis, phosphorylcholine signaling, telomerase activity, and endothelial growth factor regulation.Purity:Min. 95%Rabbit anti Bovine IgG (H + L) (rhodamine)
Rabbit anti-bovine IgG (H+L) (Rhodamine) was raised in rabbit using bovine IgG whole molecule as the immunogen.Purity:Min. 95%SS18L1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SS18L1 antibody, catalog no. 70R-3569
Purity:Min. 95%
