Biochemicals and Reagents

CABYR antibody was raised in Rabbit using Human CABYR as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SF4 antibody, catalog no. 70R-4979

MCP1 antibody was raised in rabbit using highly pure recombinant human MCP-1(MCAF) as the immunogen.

1-218 amino acids: MGSSHHHHHH SSGLVPRGSH MPMILGYWNV RGLTHPIRML LEYTDSSYDE KRYTMGDAPD FDRSQWLNEK FKLGLDFPNL PYLIDGSHKI TQSNAILRYL ARKHHLDGET EEERIRADIV ENQVMDTRMQ LIMLCYNPDF EKQKPEFLKT IPEKMKLYSE FLGKRPWFAG DKVTYVDFLA YDILDQYRMF EPKCLDAFPN LRDFLARFEG LKKISAYMKS SRYIATPIFS KMAHWSNK

DDX31 antibody was raised using a synthetic peptide corresponding to a region with amino acids QASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTS

IL15 antibody was raised in Rabbit using Human IL15 as the immunogen

Mouse monoclonal ARHGAP25 antibody

DHX58 antibody was raised in Rabbit using Human DHX58 as the immunogen

Mouse monoclonal FSHB antibody

The GPR35 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target the GPR35 receptor, which plays a crucial role in various physiological processes. This chimeric protein consists of an amino-terminal region that binds to the GPR35 receptor and a streptavidin moiety for easy detection and purification.

A synthetic peptide for use as a blocking control in assays to test for specificity of WNT4 antibody, catalog no. 70R-7471

Recombinant Human PTPN4 protein (His tag)

ANTXR2 antibody was raised in Rabbit using Human ANTXR2 as the immunogen

Rabbit Polyclonal DYNLRB2 antibody

GFI1 antibody was raised in Mouse using a purified recombinant fragment of human GFI1 expressed in E. coli as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of SFXN3 antibody, catalog no. 70R-6635

CDON antibody was raised in Rabbit using Human CDON as the immunogen

The STAP2 antibody is a highly specific and sensitive tool used for immunohistochemical detection. It is designed to target the chloride monomer, which serves as a serum marker in human serum. This antibody has been extensively tested and validated for its ability to detect STAP2 in various samples.

Purified recombinant TARDBP protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of ARR3 antibody, catalog no. 70R-9876

A synthetic peptide for use as a blocking control in assays to test for specificity of PQLC2 antibody, catalog no. 70R-6838

Mouse monoclonal CD7 antibody (FITC)

The ACRBP antibody is a highly specific monoclonal antibody that is widely used in Life Sciences research. It is commonly employed in various applications, including polymerase chain reactions (PCR), immunoblotting, and immunohistochemistry. This monoclonal antibody specifically targets α-synuclein (α-syn), an important protein involved in neurodegenerative diseases such as Parkinson's disease.

Rabbit polyclonal FOXK1 antibody

The FAM84B antibody is a highly valuable reagent in the field of Life Sciences. It is a monoclonal antibody that specifically targets the FAM84B protein, making it an excellent tool for research and diagnostic purposes. This antibody has been shown to inhibit the activity of FAM84B, which is involved in various cellular processes and pathways. By inhibiting this protein, researchers can gain valuable insights into its function and potential as a biomarker for certain diseases or conditions. The FAM84B antibody is widely used in laboratories and medical institutions as a detection reagent for studying the role of FAM84B in different biological contexts. Its high specificity and sensitivity make it an indispensable tool for scientists working in the field of Life Sciences.

Troponin T antibody (cardiac) was raised in mouse using bovine TnT as the immunogen.

Purified recombinant PROSC protein (His tag)

Rabbit Polyclonal DHRS11 antibody

The Estrogen Receptor alpha antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the estrogen receptor alpha, which plays a crucial role in various cellular processes including endothelial growth and actin filament formation. This antibody has been shown to be highly specific and activated upon binding to its target. It can be used for various applications such as immunofluorescence, Western blotting, and immunohistochemistry. Additionally, it has been found to have cross-reactivity with other proteins involved in nuclear signaling pathways, such as IFN-gamma and interleukin-6. Researchers can rely on this high-quality antibody to accurately detect and study the expression of estrogen receptor alpha in their experiments.

The CCL7 antibody is a growth factor that belongs to the TGF-beta family. It is a monoclonal antibody that targets and neutralizes CCL7, a chemokine involved in cell migration and inflammation. This antibody has been widely used in Life Sciences research to study the role of CCL7 in various biological processes. It can be used for applications such as immunohistochemistry, Western blotting, and flow cytometry. The CCL7 antibody has also shown potential therapeutic benefits in targeting specific molecules involved in collagen synthesis and endothelial growth. Additionally, it has been found to enhance the efficacy of certain antibiotics and exhibit cell cytotoxicity against multidrug-resistant bacteria. Polyclonal antibodies are also available for detecting multiple epitopes of CCL7.

The ITIH1 antibody is a highly specific monoclonal antibody that targets the influenza hemagglutinin protein. It has been extensively studied and proven to have high affinity and specificity for this target. The antibody can be used in various applications, including immunohistochemistry, western blotting, and ELISA.

The CTNNB1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the CTNNB1 protein, which is found in the apical membrane of cells. This antibody can be used in various applications such as agglutination assays and fluorescence immunochromatography to detect the presence of CTNNB1. It is commonly used in studies involving pluripotent stem cells, interferon signaling, and autoantibodies. The CTNNB1 antibody has been extensively validated and provides reliable results. With its high specificity and sensitivity, it enables accurate detection of CTNNB1 in samples such as human serum or cell lysates. Its primary amino acid sequence ensures consistent performance and reproducibility in experiments. Trust the CTNNB1 antibody for your research needs and unlock new insights into cellular processes and molecular interactions.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A22 antibody, catalog no. 70R-1751

Purified Polyclonal COPS7A antibody

NLRX1 antibody was raised in Rabbit using Human NLRX1 as the immunogen

MBD3 antibody was raised in Rabbit using Human MBD3 as the immunogen

Rabbit polyclonal VMA21 antibody

Mouse monoclonal CD152 antibody (PE)

GLI4 antibody was raised in Rabbit using Human GLI4 as the immunogen

Mouse monoclonal HIBCH antibody

CGRRF1 antibody was raised using the middle region of CGRRF1 corresponding to a region with amino acids KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIIS

Rat monoclonal Toll-like receptor 9 antibody