Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,564 products)
- By Biological Target(101,024 products)
- By Pharmacological Effects(6,952 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
C21ORF87 antibody
C21ORF87 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEARGLPCGARRTGPRRPVREMTLPSDPERATLPNPRLGAPAVPRRGPRSMRPL24 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MRPL24 antibody, catalog no. 70R-4800
Purity:Min. 95%Lamin A antibody
The Lamin A antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets the molecule known as Lamin A. This antibody has been extensively tested and proven to be effective in neutralizing Lamin A, which plays a crucial role in various cellular processes.
Ppp2r2d antibody
Ppp2r2d antibody was raised in rabbit using the C terminal of Ppp2r2d as the immunogen
Purity:Min. 95%Crystallin Mu antibody
Crystallin Mu antibody was raised using the N terminal of CRYM corresponding to a region with amino acids ALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTCENPE Antibody
The CENPE Antibody is a highly effective inhibitor and reagent that serves as a valuable biomarker in the field of Life Sciences. This monoclonal antibody is specifically designed to target and inhibit CENPE, a key protein involved in the regulation of hematopoietic and pluripotent stem cells. With its high specificity and affinity, this antibody can be used for various applications including immunohistochemical staining and detection of CENPE expression in different cell types.
VARS antibody
VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVPRXRB antibody
RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA
ZNF488 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF488 antibody, catalog no. 20R-1241Purity:Min. 95%DLL4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DLL4 antibody, catalog no. 70R-6414Purity:Min. 95%Bmp10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Bmp10 antibody, catalog no. 70R-8667Purity:Min. 95%SCG2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SCG2 antibody, catalog no. 70R-4481Purity:Min. 95%MAGEB3 antibody
MAGEB3 antibody was raised using the N terminal of MAGEB3 corresponding to a region with amino acids MPRGQKSTLHAREKRQQTRGQTQDHQGAQITATNKKKVSFSSPLILGATIGRM6 antibody
GRM6 antibody was raised in rabbit using the N terminal of GRM6 as the immunogen
Purity:Min. 95%HAL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HAL antibody, catalog no. 70R-1179Purity:Min. 95%Keratin K19 antibody
Keratin K19 antibody was raised in Guinea Pig using Acidic human keratin K18 as the immunogen.Purity:Min. 95%Shc1 antibody
The Shc1 antibody is a monoclonal antibody that specifically targets the epidermal growth factor (EGF) and its receptor. It has the ability to bind to EGF-like molecules and inhibit their activity. This antibody can also neutralize the effects of EGF by preventing its binding to receptors on cells. The Shc1 antibody is highly specific and has been extensively studied in various life science research applications. It is commonly used in experiments involving growth factors, hormones, peptides, chemokines, and other signaling molecules. Additionally, this antibody has been shown to interact with human serum albumin, a major protein found in blood plasma. Its unique characteristics make it a valuable tool for researchers in the field of molecular biology and biochemistry.Purity:Min. 95%SNAP25 protein
1-206 amino acids: MAEDADMRNE LEEMQRRADQ LADESLESTR RMLQLVEESK DAGIRTLVML DEQGEQLERI EEGMDQINKD MKEAEKNLTD LGKFCGLCVC PCNKLKSSDA YKKAWGNNQD GVVASQPARV VDEREQMAIS GGFIRRVTND ARENEMDENL EQVSGIIGNL RHMALDMGNE IDTQNRQIDR IMEKADSNKT RIDEANQRAT KMLGSGPurity:Min. 95%Sntg1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Sntg1 antibody, catalog no. 70R-9493Purity:Min. 95%Beta Tubulin 2A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TUBB2A antibody, catalog no. 70R-2909
Purity:Min. 95%ACADL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACADL antibody, catalog no. 70R-2510
Purity:Min. 95%ARF6 antibody
The ARF6 antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the ARF6 protein, which plays a crucial role in various cellular processes such as epidermal growth factor signaling and nuclear transport. This antibody has been extensively studied and has shown promising results in various applications.
p70S6 Kinase antibody
The p70S6 Kinase antibody is a highly specialized protein kinase that plays a crucial role in various cellular processes. It is involved in the regulation of cell growth, proliferation, and protein synthesis. This antibody specifically targets the p70S6 Kinase protein and can be used for research purposes.Purity:Min. 95%RELM beta protein
Region of RELM beta protein corresponding to amino acids MQCSFESLVD QRIKEALSRQ EPKTISCTSV TSSGRLASCP AGMVVTGCAC GYGCGSWDIR NGNTCHCQCS VMDWASARCC RMA.
Purity:Min. 95%GOT1 antibody
GOT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVMAGE1 antibody
The MAGE1 antibody is a highly specialized molecular weight complex that acts as a cation channel in sodium citrate. It is widely used in the field of Life Sciences for its ability to facilitate antigen-antibody reactions. This monoclonal antibody, along with Polyclonal Antibodies, has been extensively studied for its interactions with platelet fibrinogen and its DNA binding activity. With its unique composition of acid residues, the MAGE1 antibody exhibits exceptional binding affinity to various targets. It is commonly employed in research laboratories for applications such as immunohistochemistry, western blotting, and ELISA assays. Furthermore, this antibody has proven to be effective in human serum and nuclear extracts, making it an invaluable tool for studying cellular processes and disease mechanisms.PTCH1 antibody
The PTCH1 antibody is a powerful tool in the field of Life Sciences. It is widely used for various research purposes, including the study of excipients, multidrug resistance, fibronectin interaction, protein complex formation, and neutralizing growth factors. This monoclonal antibody specifically targets the PTCH1 protein, which plays a crucial role in cell signaling pathways. By binding to PTCH1, this antibody inhibits its activity and prevents downstream signaling events. Additionally, it has been shown to have low cross-reactivity with other proteins, ensuring its specificity in experiments. Whether you are studying collagen synthesis, androgen regulation, or hepatocyte growth factor signaling, the PTCH1 antibody is an essential tool that will provide reliable and accurate results.EIF2C1 antibody
EIF2C1 antibody was raised using the N terminal of EIF2C1 corresponding to a region with amino acids MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKILOC653186 antibody
LOC653186 antibody was raised using the N terminal of LOC653186 corresponding to a region with amino acids MKVINAKLDGFYSFPIFLFQFLQATAQEEGIFECADPKLAISAIWTFRDLMEIS3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MEIS3 antibody, catalog no. 70R-8734
Purity:Min. 95%
