Biochemicals and Reagents

Mouse monoclonal PSMB7 antibody

The RL10 antibody is a highly effective antibiotic that is widely used in the field of Life Sciences. It belongs to the class of monoclonal antibodies and has been specifically designed to target triglyceride lipase, a key enzyme involved in lipid metabolism. This antibody exhibits potent neutralizing activity against triglyceride lipase, making it an invaluable tool for researchers studying adipose tissue and lipoprotein metabolism.

ALPP antibody was raised in Rabbit using Human ALPP as the immunogen

Jund antibody was raised in rabbit using the N terminal of Jund as the immunogen

BSDC1 antibody was raised using the N terminal of BSDC1 corresponding to a region with amino acids VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC

C8orf77 antibody was raised in rabbit using the C terminal of C8ORF77 as the immunogen

Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific kinase essential for regulating cellular growth, survival, metabolism, and proliferation. Functioning within the PI3K/Akt/mTOR pathway, Akt responds to signals from growth factors or insulin to help cells adapt and maintain function. There are three Akt isoforms in humans—Akt1, Akt2, and Akt3—each encoded by distinct genes. Akt activation begins when these signals bind to receptors on the cell surface, activating phosphoinositide 3-kinase (PI3K), which produces PIP3 on the cell membrane. This attracts Akt to the membrane, where it becomes fully active through phosphorylation at Thr308 and Ser473, allowing it to move within the cell to phosphorylate proteins in key pathways.Akt’s primary roles include promoting cell survival by inhibiting apoptosis through inactivation of pro-apoptotic proteins like BAD and Caspase-9. It also drives cell growth and proliferation by activating mTOR, a main regulator of protein synthesis, while suppressing growth-inhibiting pathways. In metabolic regulation, Akt increases glucose uptake and glycolysis, particularly in muscle and fat tissues, through GLUT4 translocation and hexokinase activation. Additionally, Akt promotes angiogenesis by upregulating VEGF to support tissue repair and contributes to cell migration, aiding wound healing and, in cancers, tumor spread. Its broad role in cell growth and survival often leads to hyperactivation in cancers, making it a target in cancer therapies, while its influence on glucose metabolism links it to insulin signaling, where pathway defects can lead to insulin resistance and type 2 diabetes.

LIG1 antibody was raised using the middle region of LIG1 corresponding to a region with amino acids PSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF

A synthetic peptide for use as a blocking control in assays to test for specificity of COX10 antibody, catalog no. 70R-6465

Rabbit polyclonal PREB antibody

Mouse monoclonal TUBB4 antibody

CK1 epsilon antibody was raised using the N terminal of CSNK1E corresponding to a region with amino acids MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH

CD8A antibody was raised in rabbit using the middle region of CD8A as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM98B antibody, catalog no. 70R-4262

Mouse anti-human IgG is a monoclonal antibody used in Life Sciences research. It has the ability to lyse cells, making it useful for various applications such as immunoprecipitation and flow cytometry. This antibody specifically targets human IgG, allowing for the detection and quantification of IgG molecules in biological samples. In addition, Mouse anti-human IgG has been shown to neutralize the activity of growth factors such as oncostatin, TGF-alpha, and epidermal growth factor. It also inhibits the expression of E-cadherin, a protein involved in cell adhesion and migration. With its versatility and specificity, Mouse anti-human IgG is an essential tool for researchers studying various aspects of cell biology and immune response.

Rabbit polyclonal Lck antibody (Tyr393)

Mouse monoclonal JEV ED3 antibody

The TRPA1 Blocking Peptide is a highly specialized product used in Life Sciences research. It is designed to block the activity of the erythropoietin receptor, which plays a crucial role in cell growth and differentiation. This peptide can be used in various applications such as electrode immobilization, ultrasensitive detection of autoantibodies, and targeted delivery of monoclonal antibodies or other peptides and biochemicals. The TRPA1 Blocking Peptide has been extensively tested and proven to effectively inhibit the binding of erythropoietin to its receptor, making it an invaluable tool for researchers studying growth factors, helicobacter infections, and other reactive processes. Its colloidal properties ensure optimal stability and performance in experimental setups. With its ability to specifically target molecules involved in cellular activation, this blocking peptide opens up new possibilities for understanding complex biological mechanisms and developing innovative therapeutic strategies.

HIST1H2AH antibody was raised in rabbit using the C terminal of HIST1H2AH as the immunogen

MIPEP antibody was raised in Rabbit using Human MIPEP as the immunogen

TMPRSS12 antibody was raised using the middle region of TMPRSS12 corresponding to a region with amino acids KEEGNATNILQDAEVHYISREMCNSERSYGGIIPNTSFCAGDEDGAFDTC

Please enquire for more information about SPAG 16 protein including the price, delivery time and more detailed product information at the technical inquiry form on this page

Purified Mouse IgG HRP conjugate

ERBB4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Mouse monoclonal TOMM34 antibody

Rabbit polyclonal Canine Serum Albumin antibody (FITC)

SHB antibody was raised using the N terminal of SHB corresponding to a region with amino acids ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY

A synthetic peptide for use as a blocking control in assays to test for specificity of FATE1 antibody, catalog no. 70R-9918

A synthetic peptide for use as a blocking control in assays to test for specificity of RNPC3 antibody, catalog no. 70R-4642

The GPR116 antibody is a highly specialized monoclonal antibody that targets the G-protein coupled receptor 116. This antibody has been extensively used in various assays and research studies in the field of Life Sciences. It specifically inhibits the activity of GPR116, which is a family kinase inhibitor involved in regulating dopamine signaling pathways.

The Lamin B1 antibody is a polyclonal antibody that is used in various applications in the field of Life Sciences. It is specifically designed to target and bind to Lamin B1, a protein involved in nuclear structure and function. This antibody can be used for immunoassays, such as Western blotting and immunohistochemistry, to detect and quantify Lamin B1 levels in samples.

The RPS3 antibody is a highly specialized monoclonal antibody that targets a specific cell antigen. It is commonly used in Life Sciences research to study various aspects of cell growth and development. This antibody has been shown to have a high affinity for RPS3, a protein involved in the regulation of gene expression and cellular processes. Additionally, it has been found to interact with other proteins such as interleukin-6 and triglyceride lipase, suggesting its potential role in modulating immune responses and lipid metabolism. The RPS3 antibody may also be useful in detecting autoantibodies or studying the pathogenesis of certain diseases, including amyloid plaque formation. With its diverse applications and high specificity, this antibody is an invaluable tool for researchers in the field of molecular biology and immunology.

Rabbit polyclonal GABRB1 antibody

NELF antibody was raised using the middle region of NELF corresponding to a region with amino acids RERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKG

FLII antibody was raised using a synthetic peptide corresponding to a region with amino acids LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR

PHF11 antibody was raised in rabbit using the middle region of PHF11 as the immunogen

LRRFIP2 antibody was raised in mouse using recombinant Human Leucine Rich Repeat (In Flii) Interacting Protein 2

GFRA4 antibody was raised in rabbit using the C terminal of GFRA4 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of RP13-102H20.1 antibody, catalog no. 70R-7518

Region of IFN Gamma 2 protein corresponding to amino acids PVARLHGALP DARGCHIAQF KSLSPQELQA FKRAKDALEE SLLLKDCRCH SRLFPRTWDL RQLQVRERPM ALEAELALTL KVLEATADTD PALVDVLDQP LHTLHHILSQ FRACIQPQPT AGPRTRGRLH HWLYRLQEAP KKESPGCLEA SVTFNLFRLL TRDLNCVASG DLCV.