Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,015 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,371 products)
Found 130589 products of "Biochemicals and Reagents"
CK1 delta antibody
CK1 delta antibody was raised using the middle region of CSNK1D corresponding to a region with amino acids NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR
Lamin B2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LMNB2 antibody, catalog no. 70R-2421
Purity:Min. 95%UNC5C Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UNC5C antibody, catalog no. 70R-7136
Purity:Min. 95%TAPBP antibody
TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS
Purity:Min. 95%LETMD1 antibody
LETMD1 antibody was raised using the middle region of LETMD1 corresponding to a region with amino acids LLRHRLKTHTTVIHQLDKALAKLGIGQLTAQEVKSACYLRGLNSTHIGED
Purity:Min. 95%TRIM34 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM34 antibody, catalog no. 70R-8052
Purity:Min. 95%WDR34 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of WDR34 antibody, catalog no. 70R-3078
Purity:Min. 95%ATF3 antibody
The ATF3 antibody is a protein that belongs to the family of necrosis factor-related apoptosis-inducing (TNF) monoclonal antibodies. It is commonly used in Life Sciences research as a tool to study the function and expression of ATF3, a transcription factor involved in cellular stress response. This monoclonal antibody specifically binds to human mitochondrial ATF3 and has been widely used in various applications such as immunohistochemistry, Western blotting, and flow cytometry. The ATF3 antibody recognizes an antigen located on the surface of cells and can be utilized for both diagnostic and therapeutic purposes. With its high specificity and cytotoxic properties, this glycoprotein is an essential tool for researchers working in the field of molecular biology and immunology. Additionally, polyclonal antibodies targeting ATF3 are also available for those who require a broader range of reactivity.
FKBP52 antibody
The FKBP52 antibody is a highly specific monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to FKBP52, an important protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in detecting autoantibodies, histidine residues, alkaline phosphatases, epidermal growth factor (EGF), transforming growth factor-beta1 (TGF-beta1), and other growth factors.
TRKB antibody
The TRKB antibody is a monoclonal antibody that specifically targets the TRKB receptor, a protein involved in neurotrophic signaling. This antibody has been shown to bind to TRKB and inhibit its activation by tyrosine phosphorylation. It has also been demonstrated to block the interaction between TRKB and its ligands, such as brain-derived neurotrophic factor (BDNF). The TRKB antibody can be used in various research applications, including immunohistochemistry, Western blotting, and flow cytometry. It is particularly useful for studying the role of TRKB in neuronal development, synaptic plasticity, and neurodegenerative diseases. With its high specificity and affinity, the TRKB antibody is a valuable tool for researchers in the field of Life Sciences.
TMEM158 antibody
TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR
Purity:Min. 95%Avidin protein
Avidin protein is a versatile polymerase enzyme that has various applications in the field of Life Sciences. It is known for its neutralizing properties and ability to bind to a wide range of molecules, including glutamate, collagen, and human serum proteins. Avidin protein is commonly used in research laboratories for techniques such as immunohistochemistry, Western blotting, and ELISA assays. It can be conjugated with different labels, such as fluorescent dyes or enzymes, to facilitate detection and quantification of specific targets. Avidin protein has also been utilized in the development of novel drug delivery systems, such as electrospinning nanofibers loaded with imatinib. Furthermore, recombinant forms of avidin protein have been engineered to enhance its stability and binding affinity for specific enzyme substrates. Overall, avidin protein plays a crucial role in numerous scientific disciplines and continues to contribute to advancements in biotechnology and medical research.
Purity:Min. 95%Amyloid beta A4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has been conducted on this compound using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The oxidative metabolites of this drug undergo various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.
TSPYL6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TSPYL6 antibody, catalog no. 70R-1995
Purity:Min. 95%Mucin protein
Mucin protein is a cytotoxic globulin that plays a crucial role in various biological processes. It is commonly targeted by monoclonal antibodies for therapeutic purposes. These monoclonal antibodies specifically bind to mucin, neutralizing its activity and preventing the growth and spread of certain diseases. Additionally, mucin protein has been found to interact with ferritin, a key player in iron metabolism, as well as various growth factors involved in cell proliferation. Its activation can lead to lysis of activated cells and particulate matter. In the field of Life Sciences, mucin protein is extensively studied for its potential applications in diagnostics and therapeutics. Explore our range of Recombinant Proteins & Antigens to discover high-quality mucin proteins for your research needs.Purity:Min. 95%PLDN Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PLDN antibody, catalog no. 70R-2858
Purity:Min. 95%CAP1 antibody
The CAP1 antibody is a highly specialized monoclonal antibody that targets the fibronectin protein. It specifically recognizes and binds to specific amino acid residues on fibronectin, inhibiting its function. This antibody has been extensively studied in the field of Life Sciences and has shown remarkable pharmacokinetic properties.
HGD antibody
HGD antibody was raised using a synthetic peptide corresponding to a region with amino acids KLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVL
HMGCS2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HMGCS2 antibody, catalog no. 70R-1137
Purity:Min. 95%IgG1 κ Isotype Control Fc fusion protein (PE)
Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (PE)
Purity:Min. 95%SF1 antibody
SF1 antibody was raised using the N terminal of SF1 corresponding to a region with amino acids NATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQ
IL22R alpha 1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IL22RA1 antibody, catalog no. 70R-6529
Purity:Min. 95%ATP6V1G2 antibody
ATP6V1G2 antibody was raised in rabbit using the middle region of ATP6V1G2 as the immunogen
Purity:Min. 95%LOXL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LOXL1 antibody, catalog no. 70R-5381
Purity:Min. 95%Rabbit anti Goat IgG (H + L) (rhodamine)
This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.
Purity:Min. 95%CD29 antibody
The CD29 antibody is a highly effective monoclonal antibody that has multiple applications in the field of biotechnology. It can be used as a growth factor, a cdk4/6 inhibitor, and an antiviral agent. The CD29 antibody contains excipients such as globulin, which enhance its stability and efficacy. This powerful antibody has neutralizing properties and can effectively target molecules involved in various biological processes.
EDC4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EDC4 antibody, catalog no. 70R-4230
Purity:Min. 95%PRRG1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRRG1 antibody, catalog no. 70R-6809
Purity:Min. 95%ZHX3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZHX3 antibody, catalog no. 70R-9570
Purity:Min. 95%ODF3L1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ODF3L1 antibody, catalog no. 70R-3318
Purity:Min. 95%EVE Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of eve antibody, catalog no. 70R-2549
Purity:Min. 95%SPSB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SPSB2 antibody, catalog no. 70R-10124
Purity:Min. 95%OXTR antibody
OXTR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%Lamin antibody
Lamin antibody was raised in mouse using Nuclear pore complex-lamina fraction of Xenopus laevis (XLKE-A6 cells) as the immunogen.
Rabbit anti Guinea Pig IgG (H + L) (rhodamine)
Rabbit anti-guinea pig IgG (H+L) (Rhodamine) was raised in rabbit using guinea pig IgG whole molecule as the immunogen.
Purity:Min. 95%
