Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of HERC4 antibody, catalog no. 70R-8554

A synthetic peptide for use as a blocking control in assays to test for specificity of UTP23 antibody, catalog no. 70R-10099

Dihydromunduletone is a peptide inhibitor that binds to the receptor and prevents it from binding to its ligand. Dihydromunduletone is an activator of the GABA receptor, which is a ligand-gated ion channel. Dihydromunduletone also has been shown to act as an inhibitor of protein interactions, including those with other inhibitors or activators of the GABA receptor. Dihydromunduletone is a high-purity chemical reagent for use in research applications, such as pharmacology, cell biology, and biochemistry.

YGSY2P-IN-1 is a peptide that inhibits the activity of the receptor for Substance P. The peptide has a molecular weight of 2,096 Daltons and contains four amino acids: Tyr, Gly, Ser, and Phe. YGSY2P-IN-1 is competitive with respect to Substance P binding to the receptor and does not bind to other receptors. This peptide is soluble in water and has a purity of greater than 98%. It can be used as a research tool or an inhibitor in pharmacology studies.

Please enquire for more information about Alpha-hydroxyzolpidem including the price, delivery time and more detailed product information at the technical inquiry form on this page

Inhibitor of transcription activator of the Hedgehog pathway Gli

Goat polyclonal AFP antibody (Fab'2)

GBA antibody is a highly specific monoclonal antibody that targets molecules involved in necrosis factor-related apoptosis-inducing and growth factor signaling pathways. It binds to specific proteins within the protein complex, effectively neutralizing their activity. This antibody can be used in various applications in Life Sciences, including research and diagnostics. GBA antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. It has been shown to have high affinity and specificity for its target molecule, making it a valuable tool in studying various biological processes. Additionally, GBA antibody has been tested and validated in human serum samples, ensuring its reliability and accuracy in clinical settings.

Rabbit polyclonal PDHX antibody

Pyrene pe is a peptide inhibitor that binds to the active site of protein kinases and inhibits their activity. It has been used as a tool for research in cell biology and pharmacology. Pyrene pe is used as a ligand in receptor-ligand binding assays, which are used to determine the affinity of an agonist or antagonist to its receptor. The 16:0 form of pyrene pe has shown to be an activator, while the 18:1 form has shown to be an inhibitor. Pyrene pe has a molecular weight of 706.5 Da and is soluble in DMSO, methanol, and water.

BET bromodomain inhibitor selective for BDII

Affinity purified Rabbit polyclonal EIF3K antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ARHGAP28 antibody, catalog no. 70R-3943

A synthetic peptide for use as a blocking control in assays to test for specificity of E2F3 antibody, catalog no. 70R-8240

Cycloartenyl ferulate is a peptide that has been shown to inhibit the production of prostaglandin E2 and inhibit protein synthesis. Cycloartenyl ferulate inhibits protein interactions by binding to the receptor and blocking its binding site, which prevents activation of the receptor. Cycloartenyl ferulate can also be used as an activator or ligand in research tools such as antibody-drug conjugates (ADCs) or as a reagent in immunohistochemistry. Cycloartenyl ferulate is a high purity, life science product with CAS number 21238-33-5.

A synthetic peptide for use as a blocking control in assays to test for specificity of TPH2 antibody, catalog no. 70R-2005

A synthetic peptide for use as a blocking control in assays to test for specificity of MCTP1 antibody, catalog no. 70R-6811

D18024 is a peptide that belongs to the class of activator peptides. It activates the G-protein-coupled receptor (GPCR) coupled ion channels and can be used as a research tool for studying protein interactions. D18024 inhibits the activity of some ligands and receptors, such as angiotensin II, which are involved in blood pressure regulation. This peptide has been shown to activate protein kinase C, leading to phosphorylation of intracellular proteins.
D18024 is a ligand or inhibitor that binds to certain cell surface receptors and affects their function. This peptide is characterized by its high purity, with no detectable impurities on the HPLC chromatogram. CAS No: 110406-33-2

A synthetic peptide for use as a blocking control in assays to test for specificity of SPATC1 antibody, catalog no. 70R-4277

A synthetic peptide for use as a blocking control in assays to test for specificity of CEP55 antibody, catalog no. 70R-2148

GSK575594A is a novel ligand that has been shown to bind to the benzodiazepine site of the GABAA receptor. The pharmacophore of GSK575594A is based on diazepam, which is a drug that blocks the activity of the neurotransmitter acetylcholine by binding to its receptor and preventing acetylcholine from activating muscle cells. GSK575594A prevents nicotinic acetylcholine receptors from being activated by acetylcholine and can be used for the treatment of muscle spasms. GSK575594A also has an affinity for cannabinoid receptors, which are found in brain tissue, and can be used for treating anxiety disorders. In addition, it binds to allosteric sites on cholinergic receptor proteins, which may result in modulating their function.

NEDD9 antibody was raised using the middle region of NEDD9 corresponding to a region with amino acids HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH

A synthetic peptide for use as a blocking control in assays to test for specificity of LONRF3 antibody, catalog no. 70R-2616

Rabbit polyclonal ZNF238 antibody

Affinity purified Rabbit polyclonal FMO3 antibody

FGF1 protein is a recombinant protein that belongs to the class of monoclonal antibodies. It is commonly used in research and diagnostic applications. FGF1 protein has phosphatase activity and plays a crucial role in various cellular processes. It interacts with other proteins such as angptl3 and lipoprotein lipase, regulating their functions. This protein can be used in experiments involving hybridization, plasmids, and gene expression studies. FGF1 protein is also a growth factor that promotes cell proliferation and differentiation. It has neutralizing properties and can be used to block the effects of specific factors or chimeric proteins. In the field of life sciences, FGF1 protein is a valuable tool for studying adipose tissue development and related metabolic disorders.

CDH23 antibody was raised in Rabbit using Human CDH23 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of CASP6 antibody, catalog no. 70R-9652

The EFEMP1 antibody is a cytotoxic monoclonal antibody that has neutralizing properties. It specifically targets alpha-fetoprotein, a protein that is often overexpressed in certain types of cancer cells. This antibody binds to the alpha-fetoprotein and inhibits its function, leading to cell death. The EFEMP1 antibody has been extensively studied in the field of life sciences and has shown promising results as a potential medicament for cancer treatment. Additionally, it has been found to interfere with collagen synthesis and inhibit the activity of growth factors, further contributing to its anti-cancer effects. This highly specialized antibody holds great potential in the development of targeted therapies for various types of cancers.

A synthetic peptide for use as a blocking control in assays to test for specificity of TIMELESS antibody, catalog no. 20R-1198

A synthetic peptide for use as a blocking control in assays to test for specificity of TGFB3 antibody, catalog no. 70R-5699

FCGRT antibody was raised using the N terminal of FCGRT corresponding to a region with amino acids GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE

A synthetic peptide for use as a blocking control in assays to test for specificity of CLSTN1 antibody, catalog no. 70R-6778

A synthetic peptide for use as a blocking control in assays to test for specificity of MBL2 antibody, catalog no. 70R-4596

Affinity purified Rabbit polyclonal AHI1 antibody

Rabbit polyclonal DDX39B antibody (FITC)

A synthetic peptide for use as a blocking control in assays to test for specificity of RNF36 antibody, catalog no. 70R-8054

A synthetic peptide for use as a blocking control in assays to test for specificity of SMC2 antibody, catalog no. 70R-5610

KCNH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK

A synthetic peptide for use as a blocking control in assays to test for specificity of LAMP1 antibody, catalog no. 70R-9628

Mycoplasma pneumoniae antibody is a product used in Life Sciences research to study protein-protein interactions. It is a monoclonal antibody that specifically targets and binds to Mycoplasma pneumoniae, a bacterium known to cause respiratory infections. The antibody can be used in various applications such as immunohistochemical detection, fluorescence immunochromatography, and polymerase chain reactions. It is highly specific and sensitive, making it an ideal tool for detecting the presence of Mycoplasma pneumoniae in samples such as human serum or cell cultures. This antibody can also be used to study the role of Mycoplasma pneumoniae in autoimmune diseases by investigating the presence of autoantibodies. Its high affinity for Mycoplasma pneumoniae antigens ensures accurate and reliable results in research experiments.

Pneumolysin antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets pneumolysin, a protein produced by Streptococcus pneumoniae, which is responsible for causing pneumonia and other respiratory infections. This antibody has been shown to neutralize the activity of pneumolysin, preventing its damaging effects on host cells. Pneumolysin antibody can be used in various applications such as immunohistochemistry, ELISA, and Western blotting to study the role of pneumolysin in disease progression and to develop new therapeutic strategies. With its high specificity and affinity for pneumolysin, this antibody is a valuable tool for researchers in the field of infectious diseases.