Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of HP1BP3 antibody, catalog no. 70R-3142

A synthetic peptide for use as a blocking control in assays to test for specificity of PBLD antibody, catalog no. 70R-4307

TRIM59 antibody was raised using the middle region of TRIM59 corresponding to a region with amino acids LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV

A synthetic peptide for use as a blocking control in assays to test for specificity of HMBS antibody, catalog no. 70R-3343

ANAPC4 antibody was raised in Rabbit using Human ANAPC4 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of LETM2 antibody, catalog no. 70R-3573

The ENO1 antibody is a specific monoclonal antibody that targets the c-myc protein kinase. It has been shown to inhibit the growth factor signaling pathway and reduce microvessel density in monolayer cultures of MCF-7 cells. This antibody can be used for various applications, including immunohistochemistry, immunofluorescence, and Western blotting. It is highly sensitive and specific, making it an ideal tool for studying the expression and localization of ENO1 in different cell types. Additionally, this antibody has been used to detect autoantibodies against ENO1 in certain diseases, making it a valuable tool for diagnostic purposes. The ENO1 antibody is supplied as a polyclonal antibody and can be used with saponin or TGF-beta for enhanced staining results.

Rabbit polyclonal AOX1 antibody

Mouse monoclonal Cytokeratin 4+5+6+8+10+13+18 antibody (FITC)

ACADVL antibody was raised in Rabbit using Human ACADVL as the immunogen

Ki16198 is a small molecule that inhibits the growth of cancer cells by blocking the activity of the growth factor-β1. Ki16198 has been shown to inhibit tumorigenesis in a number of cell and animal models. Ki16198 also inhibits the production and secretion of matrix metalloproteinases, which are enzymes involved in tissue remodeling. Ki16198 has shown an inhibitory effect on tumor growth, with no detectable toxicity when administered orally in mice.

ELISA kit for the detection of Chlamydia Pneumoniae IgA in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of WDHD1 antibody, catalog no. 70R-7950

Region of ENA78 protein corresponding to amino acids AAVLRELRCV CLQTTQGVHP KMISNLQVFA IGPQCSKVEV VASLKNGKEI CLDPEAPFLK KVIQKILDGG NKEN.

A synthetic peptide for use as a blocking control in assays to test for specificity of RIOK2 antibody, catalog no. 70R-3721

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO16 antibody, catalog no. 70R-3782

Rabbit polyclonal ER beta antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM118A antibody, catalog no. 70R-4554

A synthetic peptide for use as a blocking control in assays to test for specificity of SEMA6D antibody, catalog no. 70R-7127

Rabbit polyclonal Collagen I alpha 2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ATXN7L1 antibody, catalog no. 70R-3220

Rabbit polyclonal SLC6A13 antibody

Affinity purified Rabbit polyclonal alpha 2 Antiplasmin antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of APOL5 antibody, catalog no. 70R-9610

KAT2B antibody was raised in Rabbit using Human KAT2B as the immunogen

MTMR2 antibody was raised in Rabbit using Human MTMR2 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of MTRR antibody, catalog no. 70R-4020

ELISA Kit for detection of IL23 in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of TGFBI antibody, catalog no. 70R-1826

The TAF1 antibody is a powerful tool in the field of Life Sciences. It specifically targets and neutralizes the endonuclease activity of TAF1, an enzyme involved in various cellular processes such as carbonic and glutamate metabolism, growth factor signaling, and histidine biosynthesis. This monoclonal antibody has been extensively tested and proven to effectively inhibit TAF1's hyaluronidase activity, which is crucial for tissue remodeling and cell migration. Additionally, it has been shown to reduce microvessel density in tumor models, making it a potential therapeutic option for angiogenesis-related disorders. With its high specificity and affinity, the TAF1 antibody is an invaluable asset for researchers in need of reliable tools to study TAF1 function and its implications in various biological processes.

A synthetic peptide for use as a blocking control in assays to test for specificity of COL8A2 antibody, catalog no. 70R-9965

EXOSC3 antibody was raised using the C terminal of EXOSC3 corresponding to a region with amino acids PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

A synthetic peptide for use as a blocking control in assays to test for specificity of PMM1 antibody, catalog no. 70R-3894

HRP-IgG conjugation kit utilizes a novel chemistry to generate highly reproducible IgG-HRP conjugates with a simple procedure. The resulting conjugates have been shown to be extremely stable, retaining 100% activity after storage for 60 days at 37º C with concentrations as low as 0.5 μg/mL.Features:

Liquid-based reagents-No reconstitution, just Mix and Go.
Completely scaleable – Conjugate anywhere from 0.1 to 1 gram IgG per reaction.
Supplies sufficient activated HRP to conjugate all IgG at a 4:1 HRP:IgG ratio.
Highly efficient HRP incorporation – conjugate purification not usually necessary.
Customize the HRP:IgG ratio to create optimized conjugates for different applications.

The HA antibody is a high-quality polyclonal antibody that is widely used in life sciences research. It is specifically designed to target and neutralize the catalase enzyme, which plays a crucial role in various biological processes. This antibody exhibits strong catalase activity and has been shown to effectively inhibit the reactive properties of catalase. Additionally, it can bind to streptavidin and other peptide agents, making it versatile for use in different experimental setups. The HA antibody is water-soluble and can be easily incorporated into various assays and experiments. It is commonly used to detect and measure antiphospholipid antibodies in human serum samples, making it an essential tool for autoimmune disease research. With its high specificity and affinity, this monoclonal antibody ensures reliable results in any scientific investigation requiring the detection or neutralization of catalase or other related enzymes.

Rat monoclonal CD19 antibody (FITC)

Mouse monoclonal RNPEP antibody

IL10 antibody is an antibody that specifically targets interleukin-10 (IL-10), a chemokine involved in immune response regulation. This antibody can be used in various research applications, such as studying the role of IL-10 in inflammation, autoimmune diseases, and cancer. It can also be used as a diagnostic tool to detect IL-10 levels in patient samples. IL10 antibody is available in both polyclonal and monoclonal forms, offering researchers different options based on their specific needs. The polyclonal antibodies are generated by immunizing animals with IL-10 protein, while the monoclonal antibodies are produced from a single clone of cells that recognize a specific epitope on IL-10. Both types of antibodies have been extensively validated for their specificity and sensitivity. Whether you're conducting experiments in Life Sciences or working on developing new therapeutics, IL10 antibody can provide valuable insights into the functions of IL-10 and its potential as a therapeutic target.

The STAT1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to the STAT1 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used for various applications such as immunohistochemistry, western blotting, and flow cytometry.

A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ44894 antibody, catalog no. 70R-8899

KCNIP4 antibody was raised in Rabbit using Human KCNIP4 as the immunogen

The RuBisCO protein is a target molecule that falls under the category of Native Proteins & Antigens. It exhibits rubisco activity and is a vital protein involved in photosynthesis. The activated form of rubisco can be neutralized by monoclonal antibodies, making it an essential tool for research and diagnostics. Additionally, this protein has potential applications as a functional sweetener and can be used in immunoassays to detect autoantibodies or as a growth factor in cell culture systems. With its diverse range of functions, the RuBisCO protein is a valuable asset in various scientific fields.

CD34 Monoclonal Antibody (FITC)