Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,570 products)
- By Biological Target(100,766 products)
- By Pharmacological Effects(6,938 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(477 products)
- Plant Biology(6,906 products)
- Secondary Metabolites(14,368 products)
Found 130507 products of "Biochemicals and Reagents"
CD55 antibody
The CD55 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize glutamate, a key molecule involved in various cellular processes. This antibody has been extensively studied for its potential therapeutic applications, particularly in the treatment of HER2-positive cancers.
Bovine IgG protein
Bovine IgG protein is a purified immunoglobulin that plays a crucial role in various biological processes. This protein has been extensively studied in the field of life sciences and has shown promising results. It has been found to be an effective inhibitor of TGF-beta, a growth factor that is responsible for various cellular functions such as cell proliferation and differentiation. Bovine IgG protein has also been shown to neutralize collagen-induced adipose tissue activation and inhibit nuclear translocation of c-myc, a protein involved in cell growth and proliferation.Purity:Min. 95%HGF Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HGF antibody, catalog no. 70R-5700
Purity:Min. 95%HBsAg antibody
HBsAg antibody is a glycoprotein that plays a crucial role in the immune response against hepatitis B virus (HBV) infection. It has catalase activity and promotes endothelial growth, making it an essential factor in various physiological processes. Additionally, HBsAg antibody has been found to be associated with antiphospholipid antibodies, which are autoantibodies that target phospholipids and can lead to blood clotting disorders. Monoclonal antibodies targeting HBsAg have shown promising results in the treatment of HBV infection. These antibodies specifically bind to the surface antigen of the virus, preventing its attachment to host cells and neutralizing its infectivity. One example of such a monoclonal antibody is trastuzumab, which is also used in the treatment of HER2-positive breast cancer. Furthermore, HBsAg antibody has been implicated in regulating cell growth and proliferation through its interaction with growth factors such as epidermal growth factor (EGF). StudiesZNF485 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF485 antibody, catalog no. 70R-8417
Purity:Min. 95%PPP2R1A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PPP2R1A antibody, catalog no. 70R-6079
Purity:Min. 95%KLF14 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KLF14 antibody, catalog no. 70R-8111
Purity:Min. 95%CCDC78 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC78 antibody, catalog no. 70R-3751
Purity:Min. 95%SFT2D3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SFT2D3 antibody, catalog no. 70R-10139
Purity:Min. 95%INHBA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of INHBA antibody, catalog no. 70R-9280
Purity:Min. 95%RASGEF1C Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RASGEF1C antibody, catalog no. 70R-5807
Purity:Min. 95%Annexin A5 antibody
The Annexin A5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of annexin, a protein involved in various cellular processes such as apoptosis and inflammation. This antibody specifically binds to annexin, allowing researchers to study its role in different biological systems.
GLA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GLA antibody, catalog no. 70R-5451
Purity:Min. 95%Thyroglobulin ELISA kit
ELISA kit for the detection of Thyroglobulin in the research laboratory
Purity:Min. 95%C16orf71 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C16orf71 antibody, catalog no. 70R-9196
Purity:Min. 95%Isorauhimbin
CAS:Isorauhimbin is an indole alkaloid, which is derived from the plant family Apocynaceae. It is primarily sourced from the bark of Rauwolfia plants, where it exists as one of the stereoisomers of yohimbine. The mode of action of Isorauhimbin involves its interaction with adrenergic receptors, specifically acting as an antagonist at the alpha-2 adrenergic receptors. This interaction results in increased release of norepinephrine and enhanced sympathetic nervous system activity.
Formula:C21H26N2O3Purity:Min. 95%Molecular weight:354.4 g/molRef: 3D-AAA48309
Discontinued productDLG3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DLG3 antibody, catalog no. 70R-6604
Purity:Min. 95%POSTN antibody
The POSTN antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and neutralize the activity of periostin (POSTN), a growth factor protein involved in various cellular processes. This antibody has been extensively tested and proven to effectively bind to POSTN, inhibiting its function.
o-Hydroxyethyl metronidazole
CAS:o-Hydroxyethyl metronidazole is an antibiotic that is used to treat infections caused by bacteria. It is a prodrug that undergoes hydrolysis in vivo to form the active compound, metronidazole. Metronidazole binds to bacterial DNA and inhibits the synthesis of proteins, leading to death of the cell. o-Hydroxyethyl metronidazole can be used for the treatment of anaerobic infections and infections caused by aerobic bacteria. The drug has been shown to be effective in treating infections of the colon, but not those of the urinary tract or respiratory tract.
Formula:C8H13N3O4Purity:Min. 95%Molecular weight:215.21 g/molEPB49 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EPB49 antibody, catalog no. 70R-10354
Purity:Min. 95%RPS9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RPS9 antibody, catalog no. 70R-10369
Purity:Min. 95%PAIP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PAIP1 antibody, catalog no. 70R-4907
Purity:Min. 95%KIAA0182 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0182 antibody, catalog no. 70R-4413
Purity:Min. 95%TRIM59 antibody
TRIM59 antibody was raised using the middle region of TRIM59 corresponding to a region with amino acids LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV
HMBS Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HMBS antibody, catalog no. 70R-3343
Purity:Min. 95%AKR1C1 antibody
AKR1C1 antibody was raised in mouse using recombinant human AKR1C1 (1-323aa) purified from E. coli as the immunogen.
Cytokeratin 4+5+6+8+10+13+18 antibody (FITC)
Mouse monoclonal Cytokeratin 4+5+6+8+10+13+18 antibody (FITC)
C330003B14RIK Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C330003B14RIK antibody, catalog no. 20R-1169
Purity:Min. 95%ENA78 protein
Region of ENA78 protein corresponding to amino acids AAVLRELRCV CLQTTQGVHP KMISNLQVFA IGPQCSKVEV VASLKNGKEI CLDPEAPFLK KVIQKILDGG NKEN.
Purity:Min. 95%ASB5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ASB5 antibody, catalog no. 70R-5995
Purity:Min. 95%Nbr1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Nbr1 antibody, catalog no. 70R-9239
Purity:Min. 95%TPR Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TPR antibody, catalog no. 70R-10241
Purity:Min. 95%Tmem184b Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Tmem184b antibody, catalog no. 70R-8663
Purity:Min. 95%ABCF2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ABCF2 antibody, catalog no. 70R-5703
Purity:Min. 95%LGICZ1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LGICZ1 antibody, catalog no. 70R-5201
Purity:Min. 95%C1ORF190 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf190 antibody, catalog no. 70R-4302
Purity:Min. 95%CD3E Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CD3E antibody, catalog no. 70R-9670Purity:Min. 95%
