Biochemicals and Reagents

MRPS2 antibody was raised using the N terminal of MRPS2 corresponding to a region with amino acids MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR

The ATXN3 antibody is a highly specific monoclonal antibody that targets the ATXN3 antigen. It is commonly used in research and diagnostic applications to detect the presence of autoantibodies against ATXN3. This antibody has been extensively validated for use in immunohistochemistry experiments, allowing researchers to study the distribution and localization of ATXN3 in various tissues and cell types.

HIV1 p17 antibody was raised in mouse using HIV1 p17 as the immunogen.

Desmoglein 3 antibody is a polyclonal antibody that specifically targets the desmoglein 3 protein. Desmoglein 3 is a component of desmosomes, which are intercellular junctions involved in cell adhesion. This antibody can be used in various research applications, including immunohistochemistry and western blotting, to study the expression and function of desmoglein 3 in different tissues and cell types.

BAY-899 is a peptide that has been shown to activate the immune system. The mechanism of action for BAY-899 is not yet fully understood but it may be an antibody or a ligand that binds to a receptor on the surface of T cells. BAY-899 is an inhibitor of ion channels and protein interactions, which may be used as research tools in cell biology and pharmacology. BAY-899 has been shown to have a high purity level, with less than 1% impurities and >95% pure as determined by HPLC analysis. The CAS number for BAY-899 is 2471967-92-5.br>br>
Bayer HealthCare Pharmaceuticals Inc.

HOXC4 antibody was raised in Rabbit using Human HOXC4 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of RBM14 antibody, catalog no. 70R-5675

The Human Kappa light chain antibody is a monoclonal antibody that specifically targets the kappa light chain of human antibodies. This antibody is widely used in Life Sciences research to study various aspects of human immune response and antibody production.

A synthetic peptide for use as a blocking control in assays to test for specificity of LIPF antibody, catalog no. 70R-5368

A synthetic peptide for use as a blocking control in assays to test for specificity of TUBA3C antibody, catalog no. 70R-2123

A synthetic peptide for use as a blocking control in assays to test for specificity of STYK1 antibody, catalog no. 70R-6389

Rabbit polyclonal RASGEF1A antibody

Peptide H-LPFFSNVTWF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of Chodl antibody, catalog no. 70R-9251

Mouse monoclonal alpha Tubulin antibody (biotin)

A synthetic peptide for use as a blocking control in assays to test for specificity of CUL4A antibody, catalog no. 70R-10348

A synthetic peptide for use as a blocking control in assays to test for specificity of NDST3 antibody, catalog no. 70R-7320

USP33 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth. Experience the powerful action of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective tuberculosis treatment.

Pneumocystis carinii antibody was raised in mouse using Pneumocystis carinii isolates as the immunogen.

METTL2B antibody was raised using the N terminal of METTL2B corresponding to a region with amino acids INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS

GABA(B) receptor antagonist

RTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV

The RASGRP4 antibody is a highly effective medicament that targets the circumsporozoite protein. This antibody specifically binds to the activated form of the protein, which is located in the nucleus. It has been shown to inhibit the activity of VEGF-C, human chorionic gonadotropin, and other antigens involved in angiogenesis. The RASGRP4 antibody can be used in immunohistochemistry studies to detect and visualize these proteins in various tissues. This product is a polyclonal antibody, meaning it is derived from multiple sources and provides a broad range of specificity. It is widely used in life sciences research to study endothelial growth factors and their role in various biological processes. With its high-quality performance and reliable results, this antibody is an essential tool for scientists and researchers working in the field of molecular biology.

The CD209 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize specific fatty acids present in biological samples. This antibody is produced using advanced chromatographic techniques, ensuring high purity and specificity. The CD209 antibody can be used for various applications, including research, diagnostics, and therapeutics. Its unique ability to bind to specific molecules makes it an invaluable tool for studying cellular processes and developing new medicaments. Whether you're a scientist or a pharmaceutical company, the CD209 antibody is an essential component of your research toolkit.

Affinity purified Rabbit polyclonal NDUFAB1 antibody

Purified recombinant Human KCTD15 protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of ERP29 antibody, catalog no. 70R-6713

A synthetic peptide for use as a blocking control in assays to test for specificity of Ankrd13d antibody, catalog no. 70R-9367

6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an active compound used as an antituberculosis drug. It belongs to the class of rifamycins and is highly effective in treating tuberculosis infections. This powerful drug works by inhibiting bacterial growth through its bactericidal activity. By binding to DNA-dependent RNA polymerase, it prevents transcription and replication, effectively stopping the spread of the infection. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Its metabolic transformations include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

A synthetic peptide for use as a blocking control in assays to test for specificity of AMBN antibody, catalog no. 70R-10326

The KLK6 antibody is an extracellular antibody that is primarily used in neuronal cultures for research purposes. This antibody specifically targets the phosphorylation site of KLK6, a protein that plays a crucial role in various biological processes within the Life Sciences field. KLK6 is known to interact with growth factors and synaptic proteins, and its activity has been linked to exocytosis and vesicular trafficking. By targeting KLK6, this polyclonal antibody can help researchers gain insights into the mechanisms of inhibitory neurotransmission and the regulation of protein isoforms. Additionally, it can be used to study the involvement of KLK6 in protein kinase signaling pathways.

COX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY

Rabbit polyclonal RAB12 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ACOT11 antibody, catalog no. 70R-5871

Rabbit anti human IgG (Fc) (Agarose Conjugated) was raised in rabbit using human IgG F(c) fragment as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of POLR2K antibody, catalog no. 70R-2961

A synthetic peptide for use as a blocking control in assays to test for specificity of LDB3 antibody, catalog no. 70R-1141

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting bacterial growth and preventing transcription and replication. In addition, it has been extensively studied using advanced techniques like patch-clamp technique on human erythrocytes. The metabolism of this drug involves various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

ELISA kit for the detection of Cardiolipin screen IgG/IgM/IgA1 in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of EPB41 antibody, catalog no. 70R-2838

Peptide H-SFNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

The AMPD1 antibody is a highly specialized product in the field of Life Sciences. It is an activated monoclonal antibody that specifically targets and detects AMPD1, an enzyme involved in fatty acid metabolism. This antibody has been extensively tested and validated for its specificity and sensitivity in various applications.

A synthetic peptide for use as a blocking control in assays to test for specificity of Abcb10 antibody, catalog no. 70R-8569

N-Omega-allyl-L-arginine is a synthetic peptide with inhibitory activity against protein interactions. It has been used as a research tool to study the activation of ion channels, receptor binding, and ligand binding. N-Omega-allyl-L-arginine is also an activator of the nitric oxide synthase enzyme. This product is a high purity, pharmaceutical grade product that can be used in life science research applications, including antibody production and cell biology.

Peptide H-VLIQFLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

ERBB2 antibody was raised in Rabbit using Human ERBB2 as the immunogen