Biochemicals and Reagents

RPE antibody was raised using the middle region of RPE corresponding to a region with amino acids MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK

Please enquire for more information about Alpha-hydroxyzolpidem including the price, delivery time and more detailed product information at the technical inquiry form on this page

ADL 5747 is a drug that binds to the δ-opioid receptor and inhibits locomotor activity. It has anxiolytic properties and may be used for the treatment of chronic pain. ADL 5747 has been shown to have antidepressant effects in animal models, which are thought to be due to its ability to activate the δ-opioid receptor. This drug also blocks μ-opioid receptors, which could lead to unwanted side effects such as respiratory depression. ADL 5747 is a potent analgesic with high affinity for δ-opioid receptors and moderate affinity for μ-opioid receptors.
ADL 5747 has been shown in human studies to bind selectively to the δ-opioid receptor, but not the μ-opioid receptor, which could lead to unwanted side effects such as respiratory depression. In addition, ADL 5747 binds with higher affinity than morphine on both the δ-opioid

A synthetic peptide for use as a blocking control in assays to test for specificity of PMM1 antibody, catalog no. 70R-3894

DDIT4L antibody was raised in Rabbit using Human DDIT4L as the immunogen

KAT2B antibody was raised in Rabbit using Human KAT2B as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of ATXN7L1 antibody, catalog no. 70R-3220

Cer1 is a synthetic peptide that is used as a research tool for studying protein interactions and receptor-ligand interactions. The amino acid sequence of Cer1 is D-Ile-Nva-D-Leu-D-Ile-Lys-NH2. Cer1 can be used to activate or inhibit ion channels, which are proteins that control the movement of ions across cell membranes. It has been shown to be an inhibitor of the Ion channel Cav3.

Inhibitor of transcription activator of the Hedgehog pathway Gli

Rabbit polyclonal ER beta antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PHYHIPL antibody, catalog no. 70R-9911

A synthetic peptide for use as a blocking control in assays to test for specificity of CASP4 antibody, catalog no. 70R-9650

Cardanol monoene is a phenolic lipid, which is a natural derivative obtained from cashew nut shell liquid. It is sourced from the renewable agricultural by-product of the Anacardium occidentale, allowing for a sustainable means of production. Its chemical structure features a phenolic ring with an aliphatic chain, which imparts unique properties that facilitate its mode of action.

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO16 antibody, catalog no. 70R-3782

FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ

The RAGE antibody is a monoclonal antibody that specifically targets the receptor for advanced glycation end products (RAGE). It is derived from human serum albumin and has been shown to have neutralizing properties against various growth factors, chemokines, and epidermal growth factor-like molecules. The RAGE antibody works by inhibiting the binding of these molecules to RAGE, thereby preventing their downstream signaling pathways. This antibody can be used in various life science research applications, such as immunohistochemistry, Western blotting, and flow cytometry. Additionally, polyclonal antibodies are also available for those who require a broader range of target recognition. With its high specificity and inhibitory effects, the RAGE antibody is a valuable tool for studying the role of RAGE in various biological processes.

A synthetic peptide for use as a blocking control in assays to test for specificity of RIOK2 antibody, catalog no. 70R-3721

Rabbit polyclonal AOX1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PTGER3 antibody, catalog no. 70R-6481

PPP1R12A antibody was raised in rabbit using the C terminal of PPP1R12A as the immunogen

Inhibitor of aldose reductase

ZAP70 antibody was raised in rabbit using the N terminal of ZAP70 as the immunogen

Ferumoxytol is used in magnetic resonance imaging (MRI) to improve the quality of images. It is given intravenously and is excreted unchanged by the kidneys. Ferumoxytol has been shown to be safe and effective for diagnosing bowel disease, including Crohn's disease, ulcerative colitis, and diverticulitis. Ferumoxytol also has been shown to be useful in evaluating cardiac function before and after myocardial infarction. Ferumoxytol has a low toxicity profile with no significant adverse effects reported during clinical trials.

The GALNT2 antibody is a monoclonal antibody that targets the GALNT2 protein. This antibody is commonly used in life sciences research, particularly in the study of growth factors and tyrosine kinase receptors. It can be used in immunoassays to detect and quantify GALNT2 levels in various biological samples.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF557 antibody, catalog no. 70R-8094

ELISA kit for detection of OPN in the research laboratory

Affinity purified Rabbit polyclonal FGFR1 antibody

Affinity purified Rabbit polyclonal Cytochrome P450 4A11 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of RFC3 antibody, catalog no. 70R-5527

A synthetic peptide for use as a blocking control in assays to test for specificity of FRZB antibody, catalog no. 70R-9273

A synthetic peptide for use as a blocking control in assays to test for specificity of AMIGO3 antibody, catalog no. 70R-7318

A synthetic peptide for use as a blocking control in assays to test for specificity of SKAP1 antibody, catalog no. 70R-5761

Dinopenton is a potent anticancer agent that targets cancer cells by inhibiting specific proteins involved in tumor growth. This inhibitor is derived from urine of Chinese medicinal plant and acts as an analog to protein kinase inhibitors. Dinopenton has been shown to induce apoptosis, or programmed cell death, in cancer cells by blocking the activity of kinases that are essential for tumor survival. This unique mechanism of action makes it a promising candidate for cancer therapy. In addition, Dinopenton has been found to have low toxicity in human studies, making it a safe and effective treatment option for cancer patients.

The STOML1 antibody is a highly specialized monoclonal antibody that targets the hepatocyte growth factor (HGF) receptor. It specifically binds to the histidine residues on the receptor, blocking its activation and inhibiting downstream signaling pathways. This antibody has been extensively studied in Life Sciences research and has shown promising results in various applications.

ML095 hydrochloride is a phosphatase inhibitor that has shown anti-tumour activity in vitro and in vivo. It inhibits the enzyme placental alkaline phosphatase (PLAP) by binding to it, thereby preventing the removal of phosphate groups from substrates. This leads to an accumulation of substrate molecules, which may have an effect on cell signalling pathways and biological functions such as cell proliferation and migration. ML095 hydrochloride has been shown to modulate cancer cell growth in vitro and in vivo. This molecule also inhibits the activity of other phosphatases including pancreatic, testicular, and intestinal enzymes.
The compound is a potent inhibitor of bladder cancer cell growth in vitro and in vivo, as well as bladder carcinoma cells that express high levels of PLAP. The compound has been shown to be safe for use by children with cancer or those who have undergone surgery for bladder cancer at doses up to 10 mg/kg body weight.

Pivopril is a drug used to treat high blood pressure (hypertension) and heart failure. Pivopril is classified as a vasodilator that prevents the constriction of blood vessels, which are caused by angiotensin II. It also blocks the production of fatty acids that cause inflammation in the intestines and reduces bowel motility. Pivopril has been shown to be effective in treating cancer; it inhibits the growth of cancer cells by interfering with their ability to produce proteins needed for cell division. The drug also stimulates the production of growth factors and increases metabolism in patients with metabolic disorders.

YM 53601 is a non-hydrolyzable analogue of the natural statin drug pravastatin. YM 53601 inhibits cholesterol synthesis by binding to the hydroxymethylglutaryl coenzyme A reductase (HMGCR) enzyme, which is involved in the conversion of HMG-CoA to mevalonate, a precursor of cholesterol. It has been shown to inhibit the replication of viruses such as HIV and influenza in animal models. YM 53601 also inhibits cell proliferation and induces apoptosis in cancer cells, as well as inhibiting fatty acid synthase and reducing levels of fatty acids in liver cells. In humans, it has been shown that YM 53601 binds to the receptor that activates adenylate cyclase and reduces cellular levels of cAMP. This inhibition has been linked to its ability to reduce inflammation and protect against cardiovascular disease.

Affinity purified Rabbit polyclonal LOC169436 antibody

Bardoxolone is a natural compound that is derived from the seeds of the plant Acacia victoriae. It has been shown to have significant cytotoxicity, with an IC50 of 0.8 mM. The mechanism of action appears to be related to the induction of reactive oxygen species and activation of mitochondrial functions, leading to apoptosis. Bardoxolone also has anti-inflammatory activities through its inhibition of NF-κB and Nf-kB pathways. Bardoxolone has also been shown to have natriuretic peptide levels in response to renal injury, as well as cardiac effects due to its nonsteroidal anti-inflammatory activity.

BMS 688521 is a fluorinated monoclonal antibody that binds to the target protein, which is expressed in inflammatory bowel disease and cancer. It has been shown to stabilize the supramolecular structure of the molecule and inhibit its degradation. The drug targets the microenvironment of the tumor to help deliver chemotherapy drugs to the tumor cells. BMS 688521 is also effective in treating bowel disease by inhibiting inflammation caused by pro-inflammatory cytokines. This drug has been shown to be safe for use in humans in clinical studies with few side effects.

A synthetic peptide for use as a blocking control in assays to test for specificity of PRR16 antibody, catalog no. 70R-3413

PG 931 is a substructural analog of pyrethroid compounds. It has been shown to be effective in the treatment of haemorrhagic disease and immunocytochemical studies have shown that PG 931 binds to neuronal cells and inhibits the production of melanocortin. PG 931 is also an insecticide with low levels of toxicity, which may be due to its non-selective mode of action.

C16orf70 antibody was raised in Rabbit using Human C16orf70 as the immunogen

For the quantitative determination of canine/dog albumin in biological samples.

A synthetic peptide for use as a blocking control in assays to test for specificity of NSUN5C antibody, catalog no. 70R-1208

Ob-1 is a small molecule that inhibits the protein Stoml3, which is a component of the voltage-gated potassium channel in neurons. It does not inhibit the sodium or calcium channels. Ob-1 has been shown to attenuate nerve injury induced by sensitizing agents such as capsaicin and formalin, as well as inhibiting diabetic neuropathy in mice. The mechanism of action for this drug is unknown, but it has been detected in nerve tissue and may be involved in pathological processes such as chronic inflammation or axonal degeneration. Ob-1 also reversibly inhibits ion channels activated by nerve injury.

A synthetic peptide for use as a blocking control in assays to test for specificity of TGOLN2 antibody, catalog no. 70R-7394