Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,620 products)
- By Biological Target(100,451 products)
- By Pharmacological Effects(6,928 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(353 products)
- Plant Biology(6,913 products)
- Secondary Metabolites(14,363 products)
Found 130328 products of "Biochemicals and Reagents"
CTSG Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CTSG antibody, catalog no. 70R-10247
Purity:Min. 95%Acp2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Acp2 antibody, catalog no. 70R-8619
Purity:Min. 95%DKK1 antibody
DKK1 antibody was raised in Mouse using a purified recombinant fragment of DKK1 expressed in E. coli as the immunogen.ANGPTL4 protein
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes.
Purity:Min. 95%WNT10B antibody
WNT10B antibody was raised in Mouse using a purified recombinant fragment of human WNT10B expressed in E. coli as the immunogen.
Human GCSF ELISA kit
ELISA kit for the detection of Human GCSF in the research laboratory
Purity:Min. 95%S100 protein (homo/heterodimer)
Purified native Human S100 beta beta and alpha beta S100 protein (homo/heterodimer)
Purity:>95% By Non-Denaturing Page And Gel Scanning.ARHGAP25 antibody
ARHGAP25 antibody was raised using the middle region of ARHGAP25 corresponding to a region with amino acids SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL
DDX3Y antibody
The DDX3Y antibody is a polyclonal antibody that has minimal toxicity and is widely used in the field of Life Sciences. It plays a crucial role in various biological processes, including colony-stimulating factor production, chemokine signaling, and immune response modulation. This antibody can be used for cytometry analysis to detect the presence of DDX3Y protein in cells or tissues.
Synaptobrevin 2 antibody
Synaptobrevin 2 antibody was raised in mouse using recombinant human Synaptobrevin 2 (1-89aa) purified from E. coli as the immunogen.Goat anti Human IgG (H + L) (HRP)
This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.Purity:Min. 95%NECAB3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NECAB3 antibody, catalog no. 70R-3495
Purity:Min. 95%SSB protein
SSB protein is a cytotoxic monoclonal antibody that neutralizes the activity of the SSB protein in human serum. This protein is involved in various biological processes, including DNA replication and repair. In Life Sciences, SSB protein plays a crucial role in the binding and stabilization of single-stranded DNA during DNA synthesis. Additionally, it interacts with other proteins such as calmodulin and a1 protein to regulate cellular functions.Purity:Min. 95%ALAD Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ALAD antibody, catalog no. 70R-3444
Purity:Min. 95%IQCE antibody
IQCE antibody was raised using the middle region of IQCE corresponding to a region with amino acids KKMGSALLSLSRSVQELTEENQSLKEDLDRVLSTSPTISKTQGYVEWSKP
MtSSB antibody
The MtSSB antibody is a diagnostic biomarker that plays a crucial role in various biological processes. It is a proline-rich protein that has been extensively studied for its potential applications in medicine. The emission of caveolin-1 and palmitate have been shown to be influenced by the presence of MtSSB antibodies. These antibodies have the ability to inhibit interferon signaling, making them valuable tools for research and diagnostics in the field of Life Sciences. As polyclonal antibodies, they can serve as a reliable detection reagent for identifying and quantifying MtSSB in samples. Additionally, their inhibitory properties make them an attractive target for developing therapeutic strategies against diseases involving reductase activity.
Cytokeratin 19 antibody
The Cytokeratin 19 antibody is a highly effective polyclonal antibody that targets and binds to Cytokeratin 19, a protein that plays a crucial role in cell adhesion and differentiation. This antibody has been extensively tested and proven to be reliable in detecting the presence of Cytokeratin 19 in various biological samples.
PHEX antibody
The PHEX antibody is a highly specialized polyclonal antibody that targets the hormone peptide interleukin-6 (IL-6). It is produced using a hybridoma cell line, which ensures high specificity and potency. This antibody acts as an inhibitory factor, neutralizing the effects of IL-6 and preventing its interaction with receptors.
Rab23 antibody
Rab23 antibody was raised in rabbit using the middle region of Rab23 as the immunogen
Purity:Min. 95%ITGB3BP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ITGB3BP antibody, catalog no. 70R-6093
Purity:Min. 95%ADSL Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ADSL antibody, catalog no. 70R-9952
Purity:Min. 95%C2ORF25 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf25 antibody, catalog no. 70R-2461
Purity:Min. 95%CDR2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CDR2 antibody, catalog no. 70R-1127
Purity:Min. 95%CEA antibody
The CEA antibody is a monoclonal antibody that specifically targets e-cadherin, a glycoprotein involved in cell adhesion. This antibody is designed to recognize and bind to e-cadherin, inhibiting its activity and preventing cell-cell interactions. The CEA antibody is commonly used in life sciences research and biochemical studies to investigate the role of e-cadherin in various cellular processes.
UPB1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UPB1 antibody, catalog no. 70R-2279
Purity:Min. 95%Beta-Casomorphin-7 (Bovine)
CAS:Beta-Casomorphin-7 is a research tool that is used in the study of cell biology and pharmacology. It is an activator of the opioid receptor and a ligand for the receptor. The Beta-Casomorphin-7 (Bovine) antibody can be used to identify receptors on cells involved in protein interactions, ion channels, and high purity. It's CAS number is 72122-62-4.
Formula:C41H55N7O9Purity:Min. 95%Molecular weight:789.92 g/molITCH Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ITCH antibody, catalog no. 70R-2367
Purity:Min. 95%CNTF protein
CNTF protein is a multifunctional cytokine that belongs to the TGF-beta superfamily. It plays a crucial role in the regulation of cell survival, differentiation, and proliferation. CNTF protein has been shown to inhibit caspase-9 activation and promote the survival of mesenchymal stem cells. It can also be used as a monoclonal antibody for various research purposes.
Purity:Min. 95%CCL2 antibody
The CCL2 antibody is a monoclonal antibody that targets the chemokine CCL2, also known as monocyte chemoattractant protein-1 (MCP-1). It is used in Life Sciences research to study the role of CCL2 in various physiological and pathological processes. This antibody specifically binds to CCL2 and can be used for applications such as immunohistochemistry, flow cytometry, and ELISA. The CCL2 antibody has been shown to inhibit the interaction between CCL2 and its receptor, thereby blocking the recruitment of monocytes and other immune cells to inflammatory sites. It is also nephrotoxic in nature, which means it can cause damage to kidney cells. Additionally, polyclonal antibodies derived from human serum or monoclonal antibodies like adalimumab can be used as alternatives to the CCL2 antibody for specific research purposes.
C19ORF24 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf24 antibody, catalog no. 70R-4955
Purity:Min. 95%KLC3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KLC3 antibody, catalog no. 70R-2518
Purity:Min. 95%CERK antibody
CERK antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%Glu(pNA) • H2O
CAS:Glu(pNA) • H2O is a substrate for the enzyme glutaminase, which hydrolyzes the peptide bond between glutamate and pyranose. The hydrolysis of Glu(pNA) • H2O to produce L-glutamic acid (Glu) and pyranose (pNA) is the first step in Glu metabolism. This reaction is important for both the production and degradation of Glu. In addition, Glu is a potent growth factor that plays a role in kidney physiology. The presence of this molecule in the extracellular space may indicate kidney disease or damage, as well as systemic effects on other organs.
Formula:C11H13N3O5•H2OPurity:Min. 95%Molecular weight:285.26 g/molCD71 antibody (Azide Free)
CD71 antibody (Azide free) was raised in rat using CD71/transferrin receptor as the immunogen.
UBE2J2 antibody
UBE2J2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK
Vamp1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Vamp1 antibody, catalog no. 70R-9794
Purity:Min. 95%Cyb5r4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Cyb5r4 antibody, catalog no. 70R-9449
Purity:Min. 95%TRMT5 antibody
TRMT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT
Donkey anti Goat IgG
Donkey anti-goat IgG was raised in donkey using goat IgG (H & L) as the immunogen.Purity:Min. 95%Proteasome 20S antibody
Proteasome 20S antibody was raised in rabbit using a Mixture of synthetic peptides corresponding to residues C R(207) V I L G N/D E L P K F Y D E(220) of human and mouse proteasome 20S LMP2 as the immunogen.
Purity:Min. 95%
