Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,622 products)
- By Biological Target(100,423 products)
- By Pharmacological Effects(6,927 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(353 products)
- Plant Biology(6,913 products)
- Secondary Metabolites(14,362 products)
Found 130307 products of "Biochemicals and Reagents"
POLR3B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of POLR3B antibody, catalog no. 70R-2297
Purity:Min. 95%GTDC1 antibody
GTDC1 antibody was raised using the N terminal of GTDC1 corresponding to a region with amino acids CQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPK
SLC6A15 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC6A15 antibody, catalog no. 70R-6563
Purity:Min. 95%RGS16 antibody
RGS16 antibody was raised using the C terminal of RGS16 corresponding to a region with amino acids DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT
CNPase antibody
The CNPase antibody is a highly specialized monoclonal antibody that is used in various research and diagnostic applications. It is specifically designed to target and bind to CNPase, an enzyme that plays a crucial role in the central nervous system. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting CNPase in human serum samples.
TNIK antibody
TNIK antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%RNF39 antibody
RNF39 antibody was raised using the N terminal of RNF39 corresponding to a region with amino acids EGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD
PABPC5 antibody
PABPC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNR
RIPK3-IN-1
CAS:RIPK3-IN-1 is a recombinant protein that activates the receptor, Receptor Interacting Protein Kinase 3 (RIPK3). RIPK3 is a member of the serine/threonine kinase family and is involved in regulating inflammatory responses. The activation of RIPK3 by RIPK3-IN-1 leads to the phosphorylation of various downstream targets, including caspases, which are involved in apoptosis. Inhibitors such as RIPK3-IN-1 may be useful for regulating inflammatory responses in diseases such as obesity, diabetes, Alzheimer's disease and arthritis.
Formula:C29H25FN4O4Purity:Min. 95%Molecular weight:512.5 g/molRef: 3D-LUD13970
Discontinued productCKMB Antibody
The CKMB Antibody is a highly specialized product in the field of Life Sciences. It is specifically designed to target creatine kinase, an enzyme that plays a crucial role in energy metabolism. This antibody is used for immobilization purposes and can be utilized in various research applications.DIRAS1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DIRAS1 antibody, catalog no. 70R-5821
Purity:Min. 95%OR2M5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OR2M5 antibody, catalog no. 70R-9871
Purity:Min. 95%PNN Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PNN antibody, catalog no. 70R-6054
Purity:Min. 95%Rat Free Thyroxine ELISA kit
ELISA Kit for detection of Free Thyroxine in the research laboratory
Purity:Min. 95%RAPGEF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RAPGEF1 antibody, catalog no. 70R-5717
Purity:Min. 95%LAB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of lab antibody, catalog no. 70R-2191
Purity:Min. 95%DPYSL2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DPYSL2 antibody, catalog no. 70R-5234
Purity:Min. 95%Phenelzine-d4 sulfate
CAS:Controlled ProductPlease enquire for more information about Phenelzine-d4 sulfate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C8H14N2O4SPurity:Min. 95%Molecular weight:238.3 g/molRef: 3D-WDC60503
Discontinued productGPR81 antibody
The GPR81 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets GPR81, a receptor involved in various cellular processes. This antibody has been extensively validated through cytotoxic assays and transcription-polymerase chain reaction (PCR) experiments.
Claudin 18 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CLDN18 antibody, catalog no. 70R-6157
Purity:Min. 95%R3HDM2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of R3HDM2 antibody, catalog no. 70R-4232
Purity:Min. 95%Tie2 antibody
The Tie2 antibody is a highly specialized monoclonal antibody that targets the carboxyl terminus of the Tie2 receptor. It is commonly used in Life Sciences research to study the role of Tie2 in various biological processes. This antibody specifically binds to human hepatocytes and has been shown to inhibit elastase activity, which is crucial for maintaining tissue integrity. The Tie2 antibody is produced using state-of-the-art hybridization techniques and purified using bovine γ-globulin and streptavidin. Its high specificity and low viscosity make it an ideal tool for studying the natriuretic properties of Tie2 and its potential therapeutic applications.
AKT3 antibody
The AKT3 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the c-myc protein, which is involved in cell growth and proliferation. This antibody has a high affinity for its target and can be used in various applications, such as Western blotting, immunohistochemistry, and flow cytometry.DPP3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DPP3 antibody, catalog no. 70R-3626
Purity:Min. 95%PVRL3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PVRL3 antibody, catalog no. 70R-6424
Purity:Min. 95%CDH1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CDH1 antibody, catalog no. 70R-6172
Purity:Min. 95%TRDMT1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRDMT1 antibody, catalog no. 70R-2240
Purity:Min. 95%GW 311616A
CAS:GW 311616A is an experimental immunomodulatory compound, which is synthesized through chemical processes designed to interact with specific biological pathways. The compound works by selectively inhibiting particular enzymes involved in the immune response, thereby modulating inflammatory processes. This mode of action allows researchers to explore its potential in regulating overactive immune systems or in conditions where immune suppression might be beneficial.
Formula:C19H31N3O4S·HClPurity:Min. 95%Molecular weight:433.99 g/molRef: 3D-XHA89044
Discontinued productGOLGA5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GOLGA5 antibody, catalog no. 70R-6969
Purity:Min. 95%ERK2 antibody
ERK2 antibody was raised in Mouse using a purified recombinant fragment of human ERK2 expressed in E. coli as the immunogen.
FBXO5 antibody
FBXO5 antibody was raised using the C terminal of FBXO5 corresponding to a region with amino acids ASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESL
PAK4 protein (His tag)
1-591 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMFG KRKKRVEISA PSNFEHRVHT GFDQHEQKFT GLPRQWQSLI EESARRPKPL VDPACITSIQ PGAPKTIVRG SKGAKDGALT LLLDEFENMS VTRSNSLRRD SPPPPARARQ ENGMPEEPAT TARGGPGKAG SRGRFAGHSE AGGGSGDRRR AGPEKRPKSS REGSGGPQES SRDKRPLSGP DVGTPQPAGL ASGAKLAAGR PFNTYPRADT DHPSRGAQGE PHDVAPNGPS AGGLAIPQSS SSSSRPPTRA RGAPSPGVLG PHASEPQLAP PACTPAAPAV PGPPGPRSPQ REPQRVSHEQ FRAALQLVVD PGDPRSYLDN FIKIGEGSTG IVCIATVRSS GKLVAVKKMD LRKQQRRELL FNEVVIMRDY QHENVVEMYN SYLVGDELWV VMEFLEGGAL TDIVTHTRMN EEQIAAVCLA VLQALSVLHA QGVIHRDIKS DSILLTHDGR VKLSDFGFCA QVSKEVPRRK SLVGTPYWMA PELISRLPYG PEVDIWSLGI MVIEMVDGEP PYFNEPPLKA MKMIRDNLPP RLKNLHKVSP SLKGFLDRLL VRDPAQRATA AELLKHPFLA KAGPPASIVP LMRQNRTRPurity:Min. 95%PP2A antibody
The PP2A antibody is a highly specialized electrode used for the detection and analysis of Polyclonal Antibodies. This antibody is specifically designed to target and bind to adipocyte markers, allowing for accurate identification and characterization of these cells. The PP2A antibody has been shown to be effective in detecting acidic glycosylation patterns on adipocytes, which play a crucial role in their function and metabolism. Additionally, this antibody has been found to modulate superoxide production in adipocytes, suggesting a potential therapeutic application in oxidative stress-related disorders. Furthermore, studies have shown that the PP2A antibody can enhance e-cadherin expression in adipocytes, promoting cellular adhesion and insulin sensitivity. With its high specificity and sensitivity, the PP2A antibody is an invaluable tool for researchers in the field of Life Sciences studying interferon signaling pathways, adipose tissue biology, fatty acid metabolism, and more.
T2AA hydrochloride
CAS:T2AA hydrochloride is a molecule that inhibits the activity of the p21 protein. This protein is involved in cell cycle regulation, and its inhibition could be beneficial for cancer treatment. T2AA hydrochloride is non-classical in structure and has been shown to inhibit prostate cancer cells by binding to their nuclear DNA. It also inhibits the secretion of phospholipase A2, which may be an important mechanism for its antitumor effects. T2AA hydrochloride binds to the receptor site on human secretory phospholipase A2, thereby inhibiting its activity. T2AA hydrochloride has been shown to inhibit viral replication through its interaction with Rna polymerase, which may lead to new treatments for some types of cancer.
Formula:C15H15I2NO3·HClPurity:Min. 95%Molecular weight:547.55 g/molRef: 3D-FFC78227
Discontinued product
