Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,678 products)
- By Biological Target(100,149 products)
- By Pharmacological Effects(6,845 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,910 products)
- Secondary Metabolites(14,344 products)
Found 130210 products of "Biochemicals and Reagents"
PINX1 antibody
PINX1 antibody was raised using the N terminal of PINX1 corresponding to a region with amino acids EKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDF
SLA/LP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLA/LP antibody, catalog no. 70R-4725
Purity:Min. 95%RPL37 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RPL37 antibody, catalog no. 70R-10389
Purity:Min. 95%IL11 protein
Region of IL11 protein corresponding to amino acids MPGPPPGPPR VSPDPRAELD STVLLTRSLL ADTRQLAAQL RDKFPADGDH NLDSLPTLAM SAGALGALQL PGVLTRLRAD LLSYLRHVQW LRRAGGSSLK TLEPELGTLQ ARLDRLLRRL QLLMSRLALP QPPPDPPAPP LAPPSSAWGG IRAAHAILGG LHLTLDWAVR GLLLLKTRL.Purity:Min. 95%RABGEF1 antibody
RABGEF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQ
Rabbit IgG ELISA Kit
Rabbit IgG ELISA Kit - For the quantitative determination of total IgG in biological samples.
Purity:Min. 95%HAV VP1 antibody
HAV VP1 antibody is a monoclonal antibody that specifically targets the HAV VP1 protein. This antibody can be used in various applications, including immunoassays and protein detection. The HAV VP1 antibody is highly specific and exhibits strong binding affinity to the target protein, ensuring accurate and reliable results.
TTC19 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TTC19 antibody, catalog no. 20R-1154
Purity:Min. 95%MESP2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MESP2 antibody, catalog no. 20R-1126
Purity:Min. 95%BBS4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BBS4 antibody, catalog no. 70R-4576
Purity:Min. 95%Tau antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
ADAR1 antibody
The ADAR1 antibody is a reactive growth factor that is commonly used in Life Sciences research. It has the ability to bind to lipoprotein lipase and serum albumin, forming a disulfide bond. This specific monoclonal antibody is highly effective in detecting autoantibodies and can be used for various applications in research and diagnostics. Additionally, it has shown binding affinity towards cations and anti-thyroglobulin antibodies. With its high specificity and sensitivity, the ADAR1 antibody is an essential tool for studying protein-protein interactions and understanding disease mechanisms.
METTL1 antibody
METTL1 antibody was raised using the middle region of METTL1 corresponding to a region with amino acids KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV
KIAA0859 antibody
KIAA0859 antibody was raised using the C terminal of KIAA0859 corresponding to a region with amino acids NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV
SOX17 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SOX17 antibody, catalog no. 70R-7976
Purity:Min. 95%AChE antibody
AChE antibody was raised in mouse using purified human cerebellar acetylcholinesterase as the immunogen.
LRRC24 antibody
LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids HLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQPL
Purity:Min. 95%Human α 1-Antitrypsin ELISA Kit
Please enquire for more information about Human Alpha 1-Antitrypsin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%POU2F2 antibody
The POU2F2 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the chemokine POU2F2 and can be used for various applications such as immunohistochemistry and Western blotting. This antibody has been shown to neutralize the activity of POU2F2, preventing its interaction with other molecules and inhibiting its function. Additionally, it can be used as a cross-linking agent in experiments involving colloidal antigen-antibody complexes. The POU2F2 antibody has high affinity and specificity, allowing for accurate detection and analysis of POU2F2 in samples. Its activated form has been shown to effectively lyse cells expressing high levels of tumor necrosis factor-alpha (TNF-α) receptors, making it a valuable tool for studying TNF-α signaling pathways.
CEP55 antibody
CEP55 antibody was raised using the N terminal of CEP55 corresponding to a region with amino acids MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK
BMP4 antibody
BMP4 antibody was raised in mouse using highly pure recombinant human BMP-4 as the immunogen.C14ORF180 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf180 antibody, catalog no. 70R-6588
Purity:Min. 95%Human Novel Coronavirus Spike glycoprotein(S),partial
Recombinant Human Novel Coronavirus Spike glycoprotein(S),partial
Purity:Min. 95%ENPEP antibody
ENPEP antibody is a monoclonal antibody that specifically targets ENPEP, an enzyme involved in the metabolism of progesterone and interferon. This antibody can be used for various applications in life sciences, including research on growth hormone receptor signaling, chemokine regulation, and steroid metabolism. It has also shown antiviral activity by inhibiting the replication of certain viruses in human serum. Additionally, this antibody has been used to detect ENPEP expression in tissues and cells using techniques such as immunohistochemistry and flow cytometry. Its high specificity and affinity make it a valuable tool for studying ENPEP-related processes and developing potential therapeutic strategies.
H2AFZ Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of H2AFZ antibody, catalog no. 70R-10298
Purity:Min. 95%ENOSF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ENOSF1 antibody, catalog no. 70R-3354
Purity:Min. 95%Asporin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ASPN antibody, catalog no. 70R-1594
Purity:Min. 95%Prealbumin protein
Prealbumin protein is a biochemical substance that is used for the treatment and/or prophylaxis of certain conditions. It can be quantitated using monoclonal antibodies specific to prealbumin protein. This protein contains histidine residues, which can serve as inhibitors of certain enzymes. Monoclonal antibody-based assays are commonly used in Life Sciences research to study the expression and function of prealbumin protein. Prealbumin protein is also known as transthyretin, a carrier protein for thyroid hormones and retinol-binding proteins. Native Proteins & Antigens, including prealbumin protein, are widely used in various research applications such as Western blotting, ELISA, and immunohistochemistry. Additionally, prealbumin protein has been implicated in anti-angiogenesis processes and may be targeted by autoantibodies in certain autoimmune diseases.Purity:Min. 95%ZNF660 antibody
ZNF660 antibody was raised in rabbit using the C terminal of ZNF660 as the immunogen
Purity:Min. 95%Plasmin protein
Plasmin protein is a pegylated, neutralizing growth factor that plays a crucial role in various Life Sciences applications. It is commonly used in the field of Proteins and Antigens for its ability to promote the growth and differentiation of mesenchymal stem cells. Additionally, plasmin protein has been found to have intraocular effects and can be used in the development of antibodies, including monoclonal antibodies.Purity:Min. 95%BAG3 antibody
BAG3 antibody was raised using the middle region of BAG3 corresponding to a region with amino acids NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS
Purity:Min. 95%ZBTB43 antibody
ZBTB43 antibody was raised in rabbit using the N terminal of ZBTB43 as the immunogen
Purity:Min. 95%
