Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,757 products)
- By Biological Target(100,261 products)
- By Pharmacological Effects(6,822 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,893 products)
- Secondary Metabolites(14,348 products)
Found 130132 products of "Biochemicals and Reagents"
beta-Amyloid/A4 Protein Precursor (APP) (96-110), analog
Catalogue peptide; min. 95% purity
Formula:C81H128N32O19S2Molecular weight:1,918.25 g/mol(S)-Luliconazole
CAS:(S)-Luliconazole is an antifungal agent that is synthesized from an imidazole compound. This compound is biphenyl in structure and is often derived through chiral synthesis techniques to isolate the (S)-enantiomer, which is the active form that enhances pharmacological effects. Its mode of action involves inhibiting the enzyme lanosterol 14α-demethylase, an essential component in fungal cell membrane synthesis. This inhibition disrupts the production of ergosterol, a critical sterol in fungal membranes, ultimately leading to increased membrane permeability and cell death.
Formula:C14H9Cl2N3S2Purity:Min. 95%Molecular weight:354.3 g/molPF 05175157
CAS:PF 05175157 is a potent small molecule, orally active inhibitor of fatty acid synthase (FAS) that causes hepatocyte steatosis in vitro and in vivo. PF 05175157 is also an inhibitor of the enzyme stearoyl-CoA desaturase 1 (SCD1), which converts saturated to monounsaturated fatty acids. The compound has been shown to reduce liver and body weight gain in mice fed a high-fat diet, as well as to improve dyslipidemia and hepatic steatosis. PF 05175157 has been evaluated clinically for the treatment of obesity, type 2 diabetes mellitus, and nonalcoholic fatty liver disease. PF 05175157 was granted orphan drug designation for the treatment of pediatric chronic kidney disease by the FDA on June 6, 2015.
Formula:C23H27N5O2Purity:Min. 95%Molecular weight:405.49 g/molRef: 3D-BCC21447
Discontinued productbeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Formula:C110H178N26O31SMolecular weight:2,392.86 g/molHypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formula:C180H287N57O48Molecular weight:4,017.55 g/mol[Ser25]-PKC (19-36) Substrate
Catalogue peptide; min. 95% purity
Formula:C93H159N35O25Molecular weight:2,167.52 g/molInsulin Receptor (1142-1153)
Catalogue peptide; min. 95% purity
Formula:C72H107N19O24Molecular weight:1,622.77 g/molPACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat)
CAS:Catalogue peptide; min. 95% purity
Formula:C121H193N33O30SMolecular weight:2,638.15 g/molAllatostatin I (free acid)
Catalogue peptide; min. 95% purity
Formula:C61H94N18O16Molecular weight:1,335.5 g/molMelanotan II, MT-Ⅱ
Catalogue peptide; min. 95% purity
Formula:C50H69N15O9Molecular weight:1,024.2 g/molTNF-α(10-36) (human)
Catalogue peptide; min. 95% purity
Formula:C131H211N43O38Molecular weight:2,996.41 g/mol[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin
Catalogue peptide; min. 95% purity
Formula:C60H87N19O14Molecular weight:1,298.48 g/molChorionic Gonadotropin-beta(109-119) amide (human)
Catalogue peptide; min. 95% purity
Formula:C51H76N16O21SMolecular weight:1,269.31 g/molICG 001
CAS:Inhibits interaction between CREB binding protein (CBP) and Wnt/β-catenin
Formula:C33H32N4O4Purity:Min. 95%Molecular weight:548.63 g/molPGC-1α (205-216), Proliferator-activated Receptor Coactivator-1 α (205-216)
Catalogue peptide; min. 95% purity
Formula:C65H109N17O19SMolecular weight:1,464.75 g/molGastrin Releasing Peptide (1-16), human
Catalogue peptide; min. 95% purity
Formula:C74H121N17O20SMolecular weight:1,600.9 g/molbeta-Lipotropin (61-64)
Catalogue peptide; min. 95% purity
Formula:C22H26N4O6Molecular weight:442.48 g/mol[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Formula:C59H89N17O14Molecular weight:1,260.47 g/molα-Conotoxin IMI
Catalogue peptide; min. 95% purity
Formula:C52H74N20O15S4Molecular weight:1,347.58 g/molDok-4 (263-275)
Catalogue peptide; min. 95% purity
Formula:C70H101N21O18Molecular weight:1,524.72 g/molPeptide YY (3-36) (canine, mouse, porcine, rat)
Catalogue peptide; min. 95% purity
Formula:C190H288N54O57Molecular weight:4,240.64 g/molH-SIYRYYGL-OH
Peptide H-SIYRYYGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt
CAS:Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a basic fibroblast growth factor that has been shown to have proliferative effects on diabetic retinopathy and ocular neovascularization. It binds to integrin receptors on the surface of cells, which are involved in cell adhesion. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt also has antiangiogenic effects and blocks the angiogenesis process by inhibiting the production of epidermal growth factor (EGF). This drug may be useful for treating certain types of cancer such as malignant brain tumors or neuroblastomas, because it can cause neuronal death. Cyclo(-Arg-Gly-Asp-D-Phe-Val) trifluoroacetate salt is a cyclic peptide with a reactive amino acid side chain.Formula:C26H38N8O7Purity:Min. 95%Molecular weight:574.63 g/molRef: 3D-FC108714
Discontinued productFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Ref: 3D-FF111724
Discontinued productH-Thr-Asp-OH TFA salt
CAS:Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C8H14N2O6C2F3HO2Purity:Min. 95%Molecular weight:348.23 g/molRef: 3D-FT108183
Discontinued productbeta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Formula:C28H45N7O9Molecular weight:623.71 g/molBoc-Phe-Gly-Gly-OH
CAS:Boc-Phe-Gly-Gly-OH is a peptide that can be used in the synthesis of peptides. It has reactive moieties and is a carboxylic acid with an aromatic amino group. Boc-Phe-Gly-Gly-OH is a site-specific catalyst that reacts with hydroxyl groups on the ligation side to form amide bonds. The catalytic mechanism of this compound involves a nucleophilic attack by the carbonyl oxygen atom on the electrophilic carbon atom, forming an intermediate iminium ion. This intermediate then tautomerizes to give the desired product and CO2.
Formula:C18H25N3O6Purity:Min. 95%Molecular weight:379.41 g/molRef: 3D-FB111238
Discontinued productBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
Catalogue peptide; min. 95% purity
Formula:C107H141N22O37PS2Molecular weight:2,422.53 g/molBudralazine
CAS:Budralazine is a synthetic vasodilator, which is derived from a series of hydrazine analogs, known for their ability to modulate vascular tone. Its mode of action involves the direct relaxation of vascular smooth muscle. This relaxation leads to a decrease in peripheral vascular resistance and, consequently, a reduction in blood pressure. Intriguingly, Budralazine is thought to selectively target arterioles over veins, making it of particular interest in the study of vascular dynamics and hypertension.
Formula:C14H16N4Purity:Min. 95%Molecular weight:240.3 g/molRef: 3D-LBA79879
Discontinued productParathyroid Hormone (1-34)-Lys(Biotin), human
Catalogue peptide; min. 95% purity
Formula:C197H317N59O54S3Molecular weight:4,472.26 g/molVX 702
CAS:p38 MAP kinase antagonist
Formula:C19H12F4N4O2Purity:Min. 95%Color and Shape:SolidMolecular weight:404.32 g/molADP-Ribosylation Factor 6, ARF6 (2-13)
Catalogue peptide; min. 95% purity
Formula:C60H102N16O17Molecular weight:1,319.58 g/molAmyloid beta-Protein (1-40) (scrambled) trifluoroacetate salt
CAS:Please enquire for more information about Amyloid beta-Protein (1-40) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C194H295N53O58SPurity:Min. 95%Molecular weight:4,329.81 g/molRef: 3D-FA110091
Discontinued productACY-775
CAS:ACY-775 is a molecule that inhibits the growth of cancer cells. It has potent inhibitory activity against epidermal growth factor (EGF) and has been shown to be effective in treating brain infarction in cell cultures. ACY-775 has also been shown to have antidepressant response in clinical studies, which may be due to its ability to block serotonin reuptake. This drug also inhibits acid formation and synaptic dysfunction, which may contribute to its effect on depression. ACY-775 binds to lysine residues on the HER2+ breast cancer cells and inhibits their growth.
Formula:C17H19FN4O2Purity:Min. 95%Molecular weight:330.36 g/molRef: 3D-BA168231
Discontinued productBAM-12P, Bovine Adrenal Medulla Docosapeptide
Catalogue peptide; min. 95% purity
Formula:C62H97N21O16S1Molecular weight:1,424.66 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SMolecular weight:5,040.74 g/mol2A/2B Dengue Protease Substrate
Catalogue peptide; min. 95% purity
Formula:C39H68N16O11Molecular weight:937.08 g/molLeucopyrokinin (LPK)
Catalogue peptide; min. 95% purity
Formula:C42H66N12O12Molecular weight:931.06 g/molHistone H3 (116-136), N15-39
Catalogue peptide; min. 95% purity
Formula:C112H197N39O30Molecular weight:2,570 g/molMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Formula:C116H190N32O35SMolecular weight:2,625 g/molLanabecestat
CAS:Lanabecestat is an investigational drug, classified as a beta-secretase (BACE) inhibitor, which is derived from synthetic chemical processes. Its mode of action involves inhibiting the enzyme beta-secretase, which plays a crucial role in the amyloidogenic pathway by cleaving amyloid precursor protein (APP) into amyloid-beta peptides. The accumulation of these peptides is a hallmark of Alzheimer's disease pathology.
Formula:C26H28N4OPurity:Min. 95%Color and Shape:PowderMolecular weight:412.53 g/molRef: 3D-IFC98264
Discontinued product(Cys26)-Amyloid b-Protein (1-40) (Dimer) trifluoroacetate salt
CAS:Please enquire for more information about (Cys26)-Amyloid b-Protein (1-40) (Dimer) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C388H588N106O114S4Purity:Min. 95%Molecular weight:8,689.73 g/mol
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
![[Cys3, 6, Tyr8, Pro10]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00673.webp&w=3840&q=75)
![[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00152.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![[Cit5]-TRAP-5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00717.webp&w=3840&q=75)
![Biotin-[Glu1]-Gastrin I (human) (phosphorylated)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00087.webp&w=3840&q=75)
