Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,559 products)
- By Biological Target(101,029 products)
- By Pharmacological Effects(6,952 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
H-TGIVSGFGR^-OH
Peptide H-TGIVSGFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Methacrylate-RGD-OH
Peptide Methacrylate-RGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Progesterone Antibody Positive Human Serum
Progesterone Antibody Positive Human Serum is a life science tool for use in IVD applications. Please enquire for more information about Progesterone Antibody Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.H-K^IADYNYKL-OH
Peptide H-K^IADYNYKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Basic blue 53
CAS:Basic blue 53 is a dye that belongs to the class of basic dyes. It is a cationic dye, which means it can be used as a switchable colorant. Basic blue 53 has been shown to be an efficient pretreating agent for cellulose acetate fiber, by removing impurities such as lignin and other polymers from the surface of this material. This dye also has hydrosilylation activity, which facilitates the production of silicone rubber. The calcium carbonate marker was found to be more soluble in a dyebath containing Basic Blue 53 than in one without this dye. These properties make it suitable for use in textile printing, papermaking, and other industries where solubility is important.Formula:C17H17I3N4SZnPurity:Min. 95%Molecular weight:755.5 g/molFmoc-Ile-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Ile-Wang resin is a polystyrene resin which is used in the synthesis of peptides. It has a high loading capacity, and can be cleaved with hydrofluoric acid. The Fmoc-Ile-Wang resin contains 1% DVB as an acidic scavenger to prevent the formation of side products. The resin is also available in 100-200 mesh size.Purity:Min. 95%Daratumumab - 20mg/ml in buffer
CAS:Monoclonal antibody against CD38; treatment for multiple myeloma
Purity:Min. 95 Area-%Color and Shape:PowderH-PYILFLSLLRPV-OH
H-PYILFLSLLRPV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-PYILFLSLLRPV-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-PYILFLSLLRPV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-PYILFLSLLRPV-OH at the technical inquiry form on this page
Purity:Min. 95%GTPBP10 antibody
GTPBP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids IILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFLH-SPARPRTSC-OH
H-SPARPRTSC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SPARPRTSC-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SPARPRTSC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SPARPRTSC-OH at the technical inquiry form on this page
Purity:Min. 95%5-FAM-LRRASLG-OH
Peptide 5-FAM-LRRASLG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ANEGTVGVSAATER-OH
H-ANEGTVGVSAATER-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ANEGTVGVSAATER-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ANEGTVGVSAATER-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ANEGTVGVSAATER-OH at the technical inquiry form on this page
Purity:Min. 95%Frovatriptan succinate
CAS:5-HT1B/1D serotonin receptor agonist; acute treatment for migraineFormula:C14H17N3O•C4H6O4Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:361.4 g/molH-SPSLIFTNR-OH
H-SPSLIFTNR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SPSLIFTNR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SPSLIFTNR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SPSLIFTNR-OH at the technical inquiry form on this page
Purity:Min. 95%H-ELAFNLPSR^-OH
Peptide H-ELAFNLPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
6-OAU
CAS:6-OAU is a chemical compound categorized as a cytokinin-like molecule, which is derived from natural plant sources. It functions by modulating gene expression and hormone pathways involved in various plant growth and developmental processes. The mode of action of 6-OAU largely revolves around mimicking the activity of cytokinins, essential plant hormones that regulate cell division, shoot and root growth, as well as delay senescence.Formula:C12H21N3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:239.31 g/molGLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat)
Catalogue peptide; min. 95% purityFormula:C165H252N44O48SMolecular weight:3,652.18 g/molAxl active human
CAS:Axl is an antibody that can be used as a research tool in cell biology. Axl is a receptor tyrosine kinase and is involved in protein-protein interactions. Axl has been shown to activate the transcription factor STAT3, which regulates inflammation and cancer. Axl also plays a role in ion channel activity and receptor phosphorylation, which may have implications for pharmacology. Axl is a high-purity product with a CAS number of 153190-63-7.
Purity:Min. 95%H-IGKPAPDFK^-OH
Peptide H-IGKPAPDFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MKNPKKKSGGFRIVC-NH2
Peptide H-MKNPKKKSGGFRIVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Copeptin (rat)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C183H307N57O61Molecular weight:4,281.8 g/molAc-LRLRGG-NH2
Peptide Ac-LRLRGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Mucin 5AC antibody
Mucin 5AC antibody was raised in mouse using M1 mucin preparation from the fluid of an ovarian mucinous cyst belonging to an O Le (a-b) patient as the immunogen.Tacrolimus
CAS:Antirheumatic; immunosuppressant; neuroprotective; neuroregenerativeFormula:C44H69NO12Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:804.02 g/molH-AVFPSIVGRPR^-OH
Peptide H-AVFPSIVGRPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
PARK7 antibody
PARK7 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKDPurity:Min. 95%H-AMRNALVRF-NH2
Peptide H-AMRNALVRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PACAP-27 (human, mouse, ovine, porcine, rat)
CAS:PACAP 1-27 (Pituitary adenylate cyclase-activating polypeptide 27) is a potent stimulator of adenylyl cyclase and increases cAMP levels.Formula:C142H224N40O39SMolecular weight:3,147.65 g/mol5Fam-F-OH
Peptide 5Fam-F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DALSSVQESQVAQQAR^-OH
Peptide H-DALSSVQESQVAQQAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RASTIEMPQQAR^-OH
Peptide H-RASTIEMPQQAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LYVE1 antibody
LYVE1 antibody was raised using the N terminal of LYVE1 corresponding to a region with amino acids ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ
Purity:Min. 95%H-VPQTPLHTSR^-OH
Peptide H-VPQTPLHTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-NVKSKIGSTENLKHQ-NH2
Peptide LCBiot-NVKSKIGSTENLKHQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Autoimmune Hepatitis Antibody Positive Human Plasma
Autoimmune Hepatitis Antibody Positive Human Plasma is a life science tool for use in IVD applications. Please enquire for more information about Autoimmune Hepatitis Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.(Asn²³)-Amyloid β-Protein (1-40)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C194H296N54O57SMolecular weight:4,328.88 g/molAc-DEPHHTQEPSTSEDNC-NH2
Ac-DEPHHTQEPSTSEDNC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-DEPHHTQEPSTSEDNC-NH2 is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-DEPHHTQEPSTSEDNC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-DEPHHTQEPSTSEDNC-NH2 at the technical inquiry form on this page
Purity:Min. 95%H-SNNQFSLDLR-OH
H-SNNQFSLDLR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SNNQFSLDLR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SNNQFSLDLR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SNNQFSLDLR-OH at the technical inquiry form on this page
Purity:Min. 95%Haptoglobin Goat Polyclonal Antibody
Haptoglobin Goat Polyclonal Antibody is a life science tool for use in IVD applications. Please enquire for more information about Haptoglobin Goat Polyclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.H-PVPGVLLKEFTVSGN-OH
H-PVPGVLLKEFTVSGN-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-PVPGVLLKEFTVSGN-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-PVPGVLLKEFTVSGN-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-PVPGVLLKEFTVSGN-OH at the technical inquiry form on this page
Purity:Min. 95%H. Pylori Flagellin Mouse Monoclonal Antibody
H. Pylori Flagellin Mouse Monoclonal Antibody is a life science tool for use in IVD applications. Please enquire for more information about H. Pylori Flagellin Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.H-FDEQLPIK^-OH
Peptide H-FDEQLPIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Luciferase antibody (FITC)
Luciferase antibody (FITC) was raised in goat using highly purified firefly luciferase as the immunogen.
Purity:Min. 95%BID amide
BID (BH3 Interacting Domain Death Agonist) is a pro-apoptotic protein and a member of the BH3-only family, which is part of the larger Bcl-2 family of proteins. BID plays a critical role in the regulation of apoptosis (programmed cell death) by linking two major pathways that trigger cell death: the extrinsic (death receptor-mediated) and intrinsic (mitochondria-mediated) pathways.BID is typically present in an inactive form in the cytosol. In response to death signals from the extrinsic apoptotic pathway, such as when death receptors (e.g., Fas or TNF receptors) are activated, BID gets cleaved by caspase-8. This cleavage produces a truncated, active form of BID called tBID (truncated BID). Once activated, tBID translocates to the mitochondria, where it interacts with pro-apoptotic Bcl-2 family proteins like Bax and Bak. This interaction causes mitochondrial outer membrane permeabilization (MOMP), leading to the release of cytochrome c and other apoptogenic factors from the mitochondria into the cytosol. The release of cytochrome c activates the caspase cascade, which ultimately leads to the execution of apoptosis.Color and Shape:PowderH-GTDVQAWIR^-OH
Peptide H-GTDVQAWIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-V^T^SGSTST^SR^-OH
Peptide H-V^T^SGSTST^SR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Methyl gentisate
CAS:Starting material for euonyminol synthesis; inhibits melanogenesisFormula:C8H8O4Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:168.15 g/molExendin-4
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C184H282N50O60SMolecular weight:4,186.63 g/mol
