Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,620 products)
- By Biological Target(100,451 products)
- By Pharmacological Effects(6,928 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(353 products)
- Plant Biology(6,913 products)
- Secondary Metabolites(14,363 products)
Found 130328 products of "Biochemicals and Reagents"
Metformin HCl - Bio-X ™
CAS:Metformin is a widely used anti-hyperglycemic (anti-diabetic) agent for the treatment of type 2 diabetes mellitus. This is due to it decreasing blood glucose by decreasing hepatic glucose product by activation of the AMP-activated protein kinase AMPK. Studies have also demonstrated Metformin to have anti-cancer activity, attributed to several mechanisms such as inhibition of mammalian target of rapamycin (mTOR), cancer stem cells and inflammation.Formula:C4H11N5•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:165.62 g/molInfluenza A H1N1 protein (New Caledonia)
Purified native Influenza A H1N1 protein (New Caledonia)Purity:Min. 95%H-SLDNGGYYISPR^-OH
Peptide H-SLDNGGYYISPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ranibizumab - 10mM histidine- histidine HCl buffer
CAS:Ranibizumab is a humanized monoclonal antibody that binds to vascular endothelial growth factor (VEGF) and blocks its action. It is used in the treatment of age-related macular degeneration and other diseases characterized by neovascularization, such as diabetic retinopathy and retinopathy of prematurity. Intravitreal ranibizumab injections have been shown to be effective for neovascular age-related macular degeneration, with a reduction in choroidal neovascularization and visual acuity improvement demonstrated in clinical trials. This drug has also been shown to reduce the incidence of new lesions in the retina and choroid, as well as to reduce or delay the development of new vessels. Ranibizumab is administered by intravitreal injection, which means it is injected into the vitreous humor inside the eye. The medication can be given alone or with bevacizumab (another VEGPurity:Min. 95 Area-%Color and Shape:Clear LiquidEBV antibody (gp250/350)
EBV antibody (gp250/350) was raised in mouse using envelope glycoprotein complex 250/350 as the immunogen.SOX4 antibody
SOX4 antibody was raised in mouse using recombinant Human Sry (Sex Determining Region Y)-Box 4 (Sox4)H-VTVFPIGIGDR^-OH
Peptide H-VTVFPIGIGDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQQQGLPRAAGGSVC-OH
H-GQQQGLPRAAGGSVC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GQQQGLPRAAGGSVC-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GQQQGLPRAAGGSVC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GQQQGLPRAAGGSVC-OH at the technical inquiry form on this page
Purity:Min. 95%H-LFLSLLRPVL-OH
H-LFLSLLRPVL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LFLSLLRPVL-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LFLSLLRPVL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LFLSLLRPVL-OH at the technical inquiry form on this page
Purity:Min. 95%Fluor-DRQIKIWFQNRRMKWKKTALDWSWLQTE-NH2
Peptide Fluor-DRQIKIWFQNRRMKWKKTALDWSWLQTE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Cys(Dpm)-OH
CAS:Fmoc-Cys(Dpm)-OH is a chemical that belongs to the group of reaction components. It is a high quality reagent for research and development and can be used as a building block in the synthesis of other fine chemicals. Fmoc-Cys(Dpm)-OH is also an intermediate for the synthesis of complex compounds such as peptides, proteins, and antibiotics. This compound has a broad range of applications in biomedicine, organic chemistry, and pharmaceuticals.
Formula:C31H27NO4SPurity:Min. 95%Color and Shape:White SolidMolecular weight:509.62 g/molPMX 53 TFA
CAS:PMX 53 TFA is a synthetic cyclic peptide, which is derived from the advanced study of complement system interactors. This product, sourced from specialized peptide synthesis methodologies, functions through the inhibition of the C5a receptor, a key player in the immune response. By blocking this receptor, PMX 53 TFA modulates inflammatory pathways, effectively reducing overactive immune responses associated with various pathological conditions.Formula:C47H65N11O7•C2HF3O2Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:1,010.11 g/molComplement C1q antibody
Complement C1q antibody was raised in sheep using human C1q as the immunogen.Purity:Min. 95%H-MGETLGDSPIDPESDSC-NH2
Peptide H-MGETLGDSPIDPESDSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Rabbit anti Sheep IgG
Rabbit anti-sheep IgG was raised in rabbit using sheep IgG F(c) fragment as the immunogen.Normal Human Serum
Normal Human Serum is an antigen for use in IVD applications. Please enquire for more information about Normal Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.Cytokeratin 8 antibody
Cytokeratin 8 antibody was raised in mouse using a purified recombinant form of human cytokeratin 8 (aa 391-483) expressed in E. coli as the immunogenSCGF beta protein
Region of SCGF protein corresponding to amino acids MGHGARGAER EWEGGWGGAQ EEEREREALM LKHLQEALGL PAGRGDENPA GTVEGKEDWE MEEDQGEEEE EEATPTPSSG PSPSPTPEDI VTYILGRLAG LDAGLHQLHV RLHALDTRVV ELTQGLRQLR NAAGDTRDAV QALQEAQGRA EREHGRLEGC LKGLRLGHKC FLLSRDFEAQ PSASPHPLSP DQPNGGTLEN CVAQASDDGS WWDHDCQRRL YYVCEFPF.Purity:Min. 95%Streptococcus Group B antibody
Streptococcus Group B antibody was raised in mouse using Group B Streptococcus as the immunogen.Fmoc-AACK-OH
Peptide Fmoc-AACK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Abz-SDK(Dnp)P-OH trifluoroacetate
CAS:Angiotensin Converting Enzyme (ACE) fluorescent peptide substrate that specifically binds to the N domain of ACEFormula:C31H38N8O13(C2HF3O2)xColor and Shape:PowderMolecular weight:730.70 g/molActivity-Dependent Neurotrophic Factor, ADNF
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C41H74N12O12Molecular weight:927.12 g/molH-DIEVQGFR^-OH
Peptide H-DIEVQGFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.RNP Antibody Positive Human Plasma
RNP Antibody Positive Human Plasma is an antigen for use in IVD applications. Please enquire for more information about RNP Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.Pal-RWKFGGFKWR-OH
Peptide Pal-RWKFGGFKWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Irinotecan hydrochloride trihydrate - Bio-X ™
CAS:Irinotecan hydrochloride trihydrate is a topoisomerase I inhibitor that is used as chemotherapy drug for colorectal cancer. By inhibiting topoisomerase I, Irinotecan hydrochloride trihydrate prevents the replication of DNA in cells, and stops the cancer cells from growing and dividing. When used for chemotherapy, Irinotecan hydrochloride trihydrate is usually part of combination therapy with other chemotherapy drugs, such as 5-fluorouracil (5-FU) and leucovorin for other cancers.Formula:C33H38N4O6•HCl•(H2O)3Purity:Min. 95%Color and Shape:PowderMolecular weight:677.18 g/molO6-Benzylguanine - Bio-X ™
CAS:O6-Benzylguanine is a guanine analog that is an antineoplastic agent. It works by acting as a suicide inhibitor of the enzyme O6-alkylguanine-DNA alkyltransferase. This results to an interruption of DNA repair so that damage can occur to local tumor targets.Formula:C12H11N5OPurity:Min. 95%Color and Shape:PowderMolecular weight:241.25 g/molChikungunya virus antibody
Chikungunya virus antibody is a highly effective solution for combating the Chikungunya virus. This antibody specifically targets and neutralizes the virus, preventing its replication and spread within the body. It works by binding to collagen, which is present on the surface of infected cells, effectively blocking the virus from entering healthy cells.alpha Actin antibody
The alpha Actin antibody is a monoclonal antibody that specifically targets and binds to alpha actin, a protein involved in muscle contraction. This antibody has various characteristics and applications in the field of Life Sciences. It can be used for research purposes to study the role of alpha actin in different biological processes. One of the key characteristics of this antibody is its cytotoxic activity. It has been shown to have a potent cytotoxic effect on human hepatocytes, inhibiting their growth and inducing cell death. This makes it a valuable tool for studying the mechanisms underlying liver diseases and potential therapeutic interventions. Additionally, the alpha Actin antibody has been found to have anti-vascular endothelial growth factor (anti-VEGF) properties. VEGF is a protein that promotes the formation of new blood vessels, and its overexpression is associated with various diseases, including cancer. By blocking VEGF activity, this antibody may help inhibit angiogenesis and tumor growth. Furthermore, this monoclonal antibody hasInsulin antibody
Insulin antibody is a monoclonal antibody that has inhibitory properties against insulin. It acts by binding to insulin and preventing its activation, thereby inhibiting its function in the body. This antibody has been shown to have inhibitory effects on various processes, including nuclear signaling pathways, chemokine production, interferon release, collagen synthesis, and the production of autoantibodies. Additionally, insulin antibody has been found to inhibit the activity of TGF-β1, a cytokine involved in cell growth and immune responses. In the field of Life Sciences, this antibody is commonly used in research studies involving insulin-related pathways and metabolism. It has also been utilized in liver microsome studies to investigate drug interactions and metabolic processes.Phosphoserine antibody
Phosphoserine antibody was raised in rabbit using phosphoserine-KLH and phosvitin mixture as the immunogen.Purity:Min. 95%OSMR antibody
OSMR antibody was raised using the N terminal of OSMR corresponding to a region with amino acids YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQPurity:Min. 95%FGF10 protein
Region of FGF10 protein corresponding to amino acids MLGQDMVSPE ATNSSSSSFS SPSSAGRHVR SYNHLQGDVR WRKLFSFTKY FLKIEKNGKV SGTKKENCPY SILEITSVEI GVVAVKAINS NYYLAMNKKG KLYGSKEFNN DCKLKERIEE NGYNTYASFN WQHNGRQMYV ALNGKGAPRR GQKTRRKNTS AHFLPMVVHS.Purity:Min. 95%CYP2C8 + CYP2C9 + CYP2C19 antibody
CYP2C8 + CYP2C9 + CYP2C19 antibody was raised in rabbit using a synthetic peptide as the immunogen.Purity:Min. 95%H-TIYVRDPTSNK-OH
H-TIYVRDPTSNK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TIYVRDPTSNK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TIYVRDPTSNK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TIYVRDPTSNK-OH at the technical inquiry form on this page
Purity:Min. 95%pE-LSEARNQSEL-OH
Peptide pE-LSEARNQSEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MDMA antibody
MDMA antibody was raised in mouse using methylenedioxymethamphetamine-BSA as the immunogen.Parainfluenza type 1 antibody
Parainfluenza type 1 antibody was raised in mouse using parainfluenza virus, type 1 as the immunogen.JNK1 antibody
JNK1 antibody was raised in sheep using purified JNK-1 yeast fusion protein as the immunogen.Purity:Min. 95%anti-β Galactosidase Antibody (Chicken) - Affinity Purified
Please enquire for more information about anti-beta Galactosidase Antibody (Chicken) - Affinity Purified including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Ac-CSAYLSRPSPFDLFIRKS-NH2
Ac-CSAYLSRPSPFDLFIRKS-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CSAYLSRPSPFDLFIRKS-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CSAYLSRPSPFDLFIRKS-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CSAYLSRPSPFDLFIRKS-NH2 at the technical inquiry form on this page
Purity:Min. 95%H-FQSGIGEK^-OH
Peptide H-FQSGIGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-ADADADADARARARAR-NH2
Peptide Ac-ADADADADARARARAR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ulipristal acetate
CAS:Progesterone receptor antagonist; contraceptive agentFormula:C30H37NO4Purity:Min. 95%Color and Shape:White PowderMolecular weight:475.62 g/molHSV1 + HSV2 ICP27 antibody
HSV1 + HSV2 ICP27 antibody was raised in mouse using herpes simplex virus regulatory ICP27 as the immunogen.CREST antibody
The CREST antibody is a monoclonal antibody that specifically targets transthyretin, a protein involved in various biological processes. This antibody is widely used in Life Sciences research and diagnostics. It can be used in a variety of applications, including immunohistochemistry, western blotting, and ELISA assays. The CREST antibody has been shown to effectively bind to transthyretin in human hepatocytes and other cell types. It can also be used as an electrode for electrochemical analysis or as a tool for antibody-mediated cytotoxicity studies. With its high specificity and binding affinity, the CREST antibody is an essential tool for researchers studying transthyretin-related diseases and exploring therapeutic options.
