Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,117 products)
- By Biological Target(99,161 products)
- By Pharmacological Effects(6,787 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,705 products)
- Secondary Metabolites(14,220 products)
Found 130581 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-VANSPLSIK-OH
<p>H-VANSPLSIK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VANSPLSIK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VANSPLSIK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VANSPLSIK-OH at the technical inquiry form on this page</p>Purity:Min. 95%TAF6 antibody
<p>TAF6 antibody was raised in mouse using recombinant Human Taf6 Rna Polymerase Ii, Tata Box Binding Protein (Tbp)-Associated Factor, 80Kda (Taf6)</p>H-NGFYPATR^-OH
<p>Peptide H-NGFYPATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VDPLETELGVK^-OH
<p>Peptide H-VDPLETELGVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALASYHWSHGQAKIS-OH
<p>H-ALASYHWSHGQAKIS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ALASYHWSHGQAKIS-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ALASYHWSHGQAKIS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ALASYHWSHGQAKIS-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-GFEPTLEALFGK^-OH
<p>Peptide H-GFEPTLEALFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQSLFDSPDFSK^-OH
<p>Peptide H-LQSLFDSPDFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Autoimmune Hepatitis Antibody Positive Human Serum
<p>Please enquire for more information about Autoimmune Hepatitis Antibody Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-AVCVLK^-OH
<p>Peptide H-AVCVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Melanotan I
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C78H111N21O19Molecular weight:1,646.9 g/molSer-Met-Asn-Pro-Ala-Arg-Ser-Phe-Gly-Pro-Ala-Val-Il
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C96H143N29O28S2Molecular weight:2,215.47 g/molEPOr antibody
<p>EPOr antibody was raised in sheep using partial cDNA of the extracellular domain of human EpoR expressed as a GST fusion protein in E. Coli as the immunogen.</p>Purity:Min. 95%GZ-793A
CAS:<p>GZ-793A is an experimental pharmacological compound, which is synthetically designed with specificity for modulating neurobiological mechanisms. It originates from advanced synthetic chemistry techniques aimed at influencing neural receptor pathways. The mode of action of GZ-793A involves selective binding to specific neurotransmitter receptors, altering synaptic transmission and potentially modulating neural activity. This binding activity allows researchers to investigate intricate signaling pathways within the central nervous system.</p>Formula:C26H37NO4·HClPurity:Min. 95%Molecular weight:464.04 g/molAc-ETFG-OH
<p>Peptide Ac-ETFG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Desmethoxy apixaban
CAS:<p>Please enquire for more information about Desmethoxy apixaban including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H23N5O3Purity:Min. 95%Color and Shape:PowderMolecular weight:429.5 g/molSIVmac239 - 10
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,618.9 g/molChlamydia Pneumoniae IgG Positive Human Plasma
<p>Please enquire for more information about Chlamydia Pneumoniae IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-NYMNLGATL-OH
<p>H-NYMNLGATL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NYMNLGATL-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NYMNLGATL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NYMNLGATL-OH at the technical inquiry form on this page</p>Purity:Min. 95%Chlamydia trachomatis antibody
<p>Chlamydia trachomatis antibody was raised in mouse using Chlamydia trachomatis LPS as the immunogen.</p>Ac-Qpy-NH2
<p>Peptide Ac-Qpy-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Synthetic SAA1 (1-76) protein (Human)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:8,575.21 g/molH-QFPILLDFK^-OH
<p>Peptide H-QFPILLDFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TTQHWLGLLGPNGTQ-OH
<p>H-TTQHWLGLLGPNGTQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TTQHWLGLLGPNGTQ-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TTQHWLGLLGPNGTQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TTQHWLGLLGPNGTQ-OH at the technical inquiry form on this page</p>Purity:Min. 95%Toxoplasma IgM Positive Human Serum
<p>Please enquire for more information about Toxoplasma IgM Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Ac-ERQRRNELKRSAFALRDQI-OH
<p>Ac-ERQRRNELKRSAFALRDQI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-ERQRRNELKRSAFALRDQI-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-ERQRRNELKRSAFALRDQI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-ERQRRNELKRSAFALRDQI-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-GFQALGDAADIR^-OH
<p>Peptide H-GFQALGDAADIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Enzalutamide
CAS:<p>Androgen receptor antagonist</p>Formula:C21H16F4N4O2SPurity:Min. 95%Color and Shape:PowderMolecular weight:464.4 g/molCardiac Troponin ITC-complex
<p>Recombinant Human Cardiac Troponin ITC-complex</p>Purity:>95% By Sds-Page[D-Trp34]-Neuropeptide Y, human
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C195H287N55O56SMolecular weight:4,329.8 g/molH-PLILLRLLRGQFC-NH2
<p>Peptide H-PLILLRLLRGQFC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RCYMNHCNTSVIQES-OH
<p>H-RCYMNHCNTSVIQES-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RCYMNHCNTSVIQES-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RCYMNHCNTSVIQES-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RCYMNHCNTSVIQES-OH at the technical inquiry form on this page</p>Purity:Min. 95%C.I.Disperse Yellow 221
CAS:<p>Please enquire for more information about C.I.Disperse Yellow 221 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-SLDNGGYYISPR^-OH
<p>Peptide H-SLDNGGYYISPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTVFPIGIGDR^-OH
<p>Peptide H-VTVFPIGIGDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LAFLQYRRL-OH
<p>H-LAFLQYRRL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LAFLQYRRL-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LAFLQYRRL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LAFLQYRRL-OH at the technical inquiry form on this page</p>Purity:Min. 95%Fluor-DRQIKIWFQNRRMKWKKTALDWSWLQTE-NH2
<p>Peptide Fluor-DRQIKIWFQNRRMKWKKTALDWSWLQTE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GRTGTYILIDMVLNRMA-OH
<p>H-GRTGTYILIDMVLNRMA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GRTGTYILIDMVLNRMA-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GRTGTYILIDMVLNRMA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GRTGTYILIDMVLNRMA-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-ERPPPVPNPDYEPIR^-OH
<p>Peptide H-ERPPPVPNPDYEPIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QELGKYEQYIKWPWY-OH TFA salt
<p>Peptide H-QELGKYEQYIKWPWY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C100H133N21O24Molecular weight:2,031.27 g/molH-DIEVQGFR^-OH
<p>Peptide H-DIEVQGFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CHRNA4 antibody
<p>CHRNA4 antibody was raised using the N terminal of CHRNA4 corresponding to a region with amino acids AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT</p>Purity:Min. 95%Chlamydia Pneumoniae IgG Positive Human Serum
<p>Chlamydia Pneumoniae IgG Positive Human Serum for diagnostics applications</p>pE-LSEARNQSEL-OH
<p>Peptide pE-LSEARNQSEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>A 485
CAS:<p>Histone acetyltransferase inhibitor of p300/CBP; anti-proliferative</p>Formula:C25H24F4N4O5Purity:Min. 95%Color and Shape:PowderMolecular weight:536.48 g/molH-LLFNK^VTLA-OH
<p>Peptide H-LLFNK^VTLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>1,3-Dipalmitoylglycerol
CAS:<p>1,3-Dipalmitoylglycerol is a diacylglycerol, which is a type of fatty acid that is also known as a 1,2-diacylglycerol. It has been shown to exhibit hemolytic activity in the presence of hydroxyl groups. The optimum pH for 1,3-dipalmitoylglycerol is at around 7.5 and it can be used as a biocompatible polymer to form controlled-release preparations with neutral pH that are tumoricidal.</p>Formula:C35H68O5Purity:Min. 95%Color and Shape:PowderMolecular weight:568.91 g/molH-KRAFSLKHI-OH
<p>H-KRAFSLKHI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KRAFSLKHI-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KRAFSLKHI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KRAFSLKHI-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-Lys-D-Trp-Phe-D-Trp-Leu-Leu-NH2
<p>H-Lys-D-Trp-Phe-D-Trp-Leu-Leu-NH2 is a potent full inverse agonist for the Ghrelin Receptor. Ghrelin is a peptide hormone that stimulates GH release from the anterior pituitary gland. Ghrelin also has other functions in the body. It binds to the ghrelin receptor and increases appetite and gastric motility. Ghrelin can also stimulate insulin secretion from pancreatic beta cells. Ghrelin levels are high before meals and decrease after eating.</p>Formula:C49H66N10O6Purity:Min. 95%Molecular weight:891.14 g/mol
![[D-Trp34]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50494.webp&w=3840&q=75)
