Biochemicals and Reagents

<p>H-IRVQQMHRPKLIGEELAQLK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IRVQQMHRPKLIGEELAQLK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IRVQQMHRPKLIGEELAQLK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IRVQQMHRPKLIGEELAQLK-OH at the technical inquiry form on this page</p>

<p>The Kanamycin antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to kanamycin, a widely used antibiotic. This antibody has been extensively tested and validated for its high specificity and sensitivity in various research applications.</p>

<p>The Cortactin antibody is a highly reactive and cytotoxic monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets cortactin, a glycoprotein involved in various cellular processes such as cell motility and cytoskeletal dynamics. This antibody has been extensively studied and validated for its ability to detect cortactin in human hepatocytes and other cell types.</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside Experience the power of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside, a potent antituberculosis drug from the rifamycins class. Specifically designed to combat tuberculosis infections, this active compound exhibits strong bactericidal activity, ensuring effective treatment. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. Through extensive research using the patch-clamp technique on human erythrocytes, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside has been proven to have a high frequency of human activity. Its active form undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally</p>

<p>Ubiquitin (12-27) is derived from ubiquitin, a protein which is added through a catalytic process to target proteins to initiate processes such as protein degradation, DNA repair, protein kinase activation and vesicle trafficking.When ubiquitin is added to a target molecule, it is first activated by an ubiquitin-activating enzyme E1 resulting in the formation of the E1-Ub thioester. It is then received by the E2 ubiquitin conjugating enzyme and then transferred onto a lysine residue of the target protein by the E3 ubiquitin ligase.Ubiquitin plays a major role in protein degradation due to the formation of a polyubiquitin chain. This is produced when the lysine-48 residue on ubiquitin is itself ubiquitinated and sequentially followed by the further addition of ubiquitin molecules. The target protein which now contains the polyubiquitinated chain is recognised by the 26s proteasome and degraded.Alternatively monoubiquitination signals can initiate processes such as receptor internalisation and DNA repair. Specifically polyubiquitin chains on lysine 63 residues can regulate processes such as protein kinase activation and vesicle trafficking.</p>

<p>Peptide LCBiot-DAEFRHDSGYEVHHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>BMH-23 is a small molecule compound, which is derived from chemical synthesis. It functions primarily as an inhibitor targeting the interaction between the p53 tumor suppressor protein and MDM2, a critical negative regulator of p53. This selective inhibition leads to the stabilization and activation of p53, resulting in the induction of cell cycle arrest and apoptosis in p53-functional cancer cells.</p>

<p>Parecoxib is a COX-2 inhibitor and belongs to the group of pharmacological agents. It is a prodrug of valdecoxib that is used for the treatment of osteoarthritis and rheumatoid arthritis, as well as other conditions where the reduction in pain and inflammation are desired.</p>

<p>H-AVEPQLEDDER-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AVEPQLEDDER-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AVEPQLEDDER-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AVEPQLEDDER-OH at the technical inquiry form on this page</p>

<p>H-SYLKTNAFL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SYLKTNAFL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SYLKTNAFL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SYLKTNAFL-OH at the technical inquiry form on this page</p>

<p>GPR177 antibody was raised using the N terminal of GPR177 corresponding to a region with amino acids ARKNHHKTKWFVPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPHME</p>

<p>Fragment of Family with sequence similarity 49 member B (FAM49B), a mitochondria-localized protein that regulates mitochondrial fission and cancer progression. Within tumour environments, such as those seen in pancreatic ductal adenocarcinoma, the expression of FAM49B is reduced. The ability of FAM49B to control redox reactions in the mitochondria allows it to suppress cancer cell proliferation.</p>

<p>H-ALASYHWSHGQAKIS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ALASYHWSHGQAKIS-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ALASYHWSHGQAKIS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ALASYHWSHGQAKIS-OH at the technical inquiry form on this page</p>

<p>Mouse monoclonal LDH Pan antibody</p>

<p>CA 15-3 antibody was raised in mouse using purified native MUC1 as the immunogen.</p>

<p>The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication.  NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (326-340) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.</p>

<p>Peptide H-GLNVTLSSTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Temporin A is a short, linear, basic and highly hydrophobic anti-microbial peptide (AMP) isolated from the frog, Rana temporaria. Temporin A is particularly active against Gram-positive bacteria including those arranged in biofilms. Temporin A is also active against some Gram-negative bacteria and Leishmania parasites.Temporin A adopts an alpha-helical conformation in a membrane-mimicking environment and is able to perturb the membrane of microbial cells. Temporin A is practically non-haemolytic up to concentrations five-times higher than their minimum inhibitory concentration (MIC) against Gram-positive bacteria.</p>

<p>Conjugated Cortisol 3 CMO-HRP hapten</p>

<p>HIF prolyl-hydroxylase inhibitor for treatment of anaemia</p>

<p>Helicobacter pylori protein is a protein that plays a role in various biological processes. It has been shown to interact with TGF-beta and natriuretic peptides, suggesting its involvement in signaling pathways related to these molecules. Monoclonal antibodies targeting this protein have been developed for use in Life Sciences research, allowing for its detection and immobilization. Additionally, it has been found to bind fatty acids and interact with other human proteins, such as fibrinogen. Studies have also suggested that Helicobacter pylori protein may exhibit cytotoxic effects and be involved in the regulation of caspase-9 activity. Its multifaceted nature makes it an intriguing subject of study in the field of Native Proteins &amp; Antigens.</p>

<p>Recombinant chimeric antibody containing variable region from mouse IgG and constant region from human IgG1, cultured in vitro under conditions free from animal-derived components.</p>

<p>Brinzolamide is a carbonic anhydrase inhibitor this is used for the treatment of ocular hypertension and glaucoma. Inhibition of carbonic anhydrase slows the formation of bicarbonate ions and as a result of this, it slows fluid flow in the eye, lowering the intraocular pressure. It has a high lipophilicity to enable diffusion across the blood-retinal barrier.</p>

<p>Represents the extracellular region of amyloid β peptide (Aβ). This region may be responsible for the conformational changes seen in Aβ and is cytotoxic in vitro.Aβ has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer disease (AD) and Down syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then &amp;γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.</p>

<p>Peptide H-GADGVGK^SA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Eα antigen peptide, known to bind with high affinity to the major histocompatibility complex (MHC) class II molecule IAb. MHC class II molecules are normally found on antigen presenting cells such as dendritic cells, mononuclear phagocytes, endothelial cells, thymic epithelial cells and B cells and they present antigens derived from extracellular proteins. Eα peptide bound to IAb is specifically recognized by Y-Eα antibody.This peptide contains a C-terminal biotin tag for simple detection and purification.  The linker is ethylenediamine.</p>

<p>H-LAHSFLNGTNALPHS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LAHSFLNGTNALPHS-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LAHSFLNGTNALPHS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LAHSFLNGTNALPHS-OH at the technical inquiry form on this page</p>

<p>CRP antibody was raised in goat using human CRP affinity pure as the immunogen.</p>

<p>Rabbit polyclonal Gamma enolase antibody (HRP)</p>

<p>H-LSAGSAP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LSAGSAP-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LSAGSAP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LSAGSAP-OH at the technical inquiry form on this page</p>

<p>Peptide H-ELFSYLIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Non-benzodiazepine-type anxiolytic drug; used various types of anxiety disorders</p>

<p>Peptide H-SGTDVDAANL^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-CSRPSPFDLFIRKSPTIT-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CSRPSPFDLFIRKSPTIT-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CSRPSPFDLFIRKSPTIT-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CSRPSPFDLFIRKSPTIT-NH2 at the technical inquiry form on this page</p>

<p>H-MRMATPLLM-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-MRMATPLLM-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-MRMATPLLM-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-MRMATPLLM-OH at the technical inquiry form on this page</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Chlamydia pneumoniae OMP recombinant protein</p>

<p>C.I.Reactive Yellow 84 is a sulfate that is used in analytical chemistry to quantify an unknown amount of potassium chloride. This compound can be quantified using anova, which is a statistical method for comparing several different treatments in order to determine which treatments have the largest effect. C.I.Reactive Yellow 84 can also be quantified by electrolysis, which involves passing an electric current through a solution and measuring the electrical charge created by the reaction between hydrogen ions and electrons from the cathode during the process of oxidation-reduction reactions with the electrolyte (solution). The reactive square can also be used to quantify C.I.Reactive Yellow 84, as it provides a comparison between two reactants and allows for optimization of reaction time and spectra over time.</p>

<p>IL6 antibody was raised in rabbit using highly pure recombinant hIL-6 as the immunogen.</p>

<p>H-IETQDIQALR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IETQDIQALR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IETQDIQALR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IETQDIQALR-OH at the technical inquiry form on this page</p>

<p>H-IAISLDTSK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IAISLDTSK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IAISLDTSK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IAISLDTSK-OH at the technical inquiry form on this page</p>

<p>H-TSESGELHGC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TSESGELHGC-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TSESGELHGC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TSESGELHGC-NH2 at the technical inquiry form on this page</p>

<p>Agonist of ghrelin receptor; growth hormone secretagog</p>

<p>Adenovirus E1A antibody was raised in sheep using GST-E1A fusion protein as the immunogen.</p>

<p>C.I. Solvent Yellow 189 is a monomer that is used in coatings, paints, and printing inks. It is a polymeric dye with high activity and excellent light resistance. The hydrophobic nature of this dye makes it ideal for use in coatings that require water-repellent or weatherproof properties. C.I. Solvent Yellow 189 has been shown to be reactive with formamide as well as styryl dyes to form copolymers with high crosslinked content for high-performance devices such as light barriers and filters.</p>

<p>Peptide H-NDEELNKLLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DYVSQFEGSALGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Purified Human secretory IgA protein</p>

<p>HIV1 nef antibody was raised in mouse using HIV-1 nef (amino acids 163-173) as the immunogen.</p>