CymitQuimica logo
Biochemicals and Reagents

Biochemicals and Reagents

Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.

Subcategories of "Biochemicals and Reagents"

Found 130493 products of "Biochemicals and Reagents"

Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
products per page.
  • β-Amyloid (37-43)
    Biosynth
    + Info

    β-Amyloid (37-43)

    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Formula:C27H49N7O9
    Molecular weight:615.73 g/mol

    Ref: 3D-PP50020

    ne
    To inquire
  • Treponema pallidum p15 protein
    Biosynth
    + Info

    Treponema pallidum p15 protein

    The E.Coli derived recombinant protein is fused at N-terminus with GST tag and contains the Trp. Pallidum p15 immunodominant regions.
    Purity:Min. 95%

    Ref: 3D-30R-AT065

    ne
    To inquire
  • TBE IgM Positive Human Plasma
    Biosynth
    + Info

    TBE IgM Positive Human Plasma

    TBE IgM Positive Human Plasma is a life science tool for use in IVD applications. Please enquire for more information about TBE IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-CE5988

    ne
    To inquire
  • Influenza A/B, SARS-CoV-2 and R&V Negative Nasopharyngeal Swab (Copan UTM)
    Biosynth
    + Info

    Influenza A/B, SARS-CoV-2 and R&V Negative Nasopharyngeal Swab (Copan UTM)

    Influenza A/B, SARS-CoV-2 and R&V Negative Nasopharyngeal Swab (Copan UTM) is a life science tool for use in IVD applications. Please enquire for more information about Influenza A/B, SARS-CoV-2 and R&V Negative Nasopharyngeal Swab (Copan UTM) including the price, delivery time and more detailed product information at the technical inquiry form on this page.
    Color and Shape:Powder

    Ref: 3D-DB8387

    ne
    To inquire
  • ASO Antibody Positive Human Plasma
    Biosynth
    + Info

    ASO Antibody Positive Human Plasma

    ASO Antibody Positive Human Plasma is a life science tool for use in IVD applications. Please enquire for more information about ASO Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-AT5178

    ne
    To inquire
  • SARS-CoV-2 Spike S1-S2 Chimeric Antigen, Recombinant
    Biosynth
    + Info

    SARS-CoV-2 Spike S1-S2 Chimeric Antigen, Recombinant

    Presented as a purified antigen in proprietary buffer, pH 10. This recombinant SARs-CoV-2 Spike S1-S2 chimeric protein has been expressed in insect cells and purified by chromatography. It is important to note that repeated freezing and thawing should be avoided and it is suitable for ELISA assays and similar solid phase formats. The severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), causes the Coronavirus Disease-2019 (COVID-19) and has dominated the world’s scientific attention since it was first reported in December 2019. Symptoms, which may include shortness of breath and fever, result from SARs-CoV-2 binding to the host cell receptors: angiotensin-converting enzyme 2 (ACE2) present in the arterial smooth muscle cells and endothelial cells and additionally venous endothelial cells in organs. This interaction is carried out by the SARs-CoV-2’s spike protein. Of the two subunits that this spike protein is composed of, S1 binds the ACE2 receptors through its receptor binding domain while S2 initiates membrane fusion between the virus and host through forming a hairpin structure. While the spike protein subunits can be collectively used as the immunogen in vaccine development, the receptor binding domain in the S1 subunit is of particular interest for the development of neutralizing antibodies. Interestingly a proline substitution within the S2 domain enhances the immunogenicity of this spike protein.
    Color and Shape:Clear Liquid

    Ref: 3D-BM6422

    1mg
    To inquire
    -Unit-mgmg
    To inquire
  • H-DPEGVPPLLVSQQAK^-OH
    Biosynth
    + Info

    H-DPEGVPPLLVSQQAK^-OH

    Peptide H-DPEGVPPLLVSQQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49456

    ne
    To inquire
  • H-GSMVVIPTYALHHDPK^-OH
    Biosynth
    + Info

    H-GSMVVIPTYALHHDPK^-OH

    Peptide H-GSMVVIPTYALHHDPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46857

    ne
    To inquire
  • Haemoglobin A1c Solution (<3.5% HbA1c)
    Biosynth
    + Info

    Haemoglobin A1c Solution (<3.5% HbA1c)

    Haemoglobin A1c Solution (<3.5% HbA1c) is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Haemoglobin A1c Solution (<3.5% HbA1c) including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Color and Shape:Clear Liquid

    Ref: 3D-AJ3182

    ne
    To inquire
  • Cardiolipin IgG/β-2-Glycoprotein-1 IgG Positive Human Plasma
    Biosynth
    + Info

    Cardiolipin IgG/β-2-Glycoprotein-1 IgG Positive Human Plasma

    Cardiolipin IgG/Beta-2-Glycoprotein-1 IgG Positive Human Plasma is a life science tool for use in IVD applications. Please enquire for more information about Cardiolipin IgG/Beta-2-Glycoprotein-1 IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.
    Purity:Min. 95%

    Ref: 3D-BV5947

    ne
    To inquire
  • alpha CGRP antibody
    Biosynth
    + Info

    alpha CGRP antibody

    The alpha CGRP antibody is a monoclonal antibody that specifically targets and neutralizes the activity of calcitonin gene-related peptide (CGRP). CGRP is a neuropeptide that plays a key role in various physiological processes, including pain transmission, vasodilation, and inflammation. By blocking the action of CGRP, this antibody can provide therapeutic benefits for conditions such as migraine headaches. This antibody has been extensively studied and shown to effectively inhibit the activation of CGRP receptors. It binds to CGRP with high affinity and prevents its interaction with its receptor on target cells. This blockade of CGRP signaling leads to a reduction in pain perception and inflammation. In addition to its role in pain management, the alpha CGRP antibody has also shown promise in other areas of research. It has been investigated for its potential use in treating autoimmune disorders, as it can modulate immune responses by targeting autoantibodies. Furthermore, studies have suggested that this antibody may have anti-tumor properties by inhibiting

    Ref: 3D-10-1762

    200µl
    3,144.00€
  • GPC Antibody Positive Human Plasma
    Biosynth
    + Info

    GPC Antibody Positive Human Plasma

    GPC Antibody Positive Human Plasma is a life science tool for use in IVD applications. Please enquire for more information about GPC Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-CF5486

    ne
    To inquire
  • Bacteremia Positive Human Whole Blood
    Biosynth
    + Info

    Bacteremia Positive Human Whole Blood

    Bacteremia Positive Human Whole Blood is a life science tool for use in IVD applications. Please enquire for more information about Bacteremia Positive Human Whole Blood including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-DF8327

    ne
    To inquire
  • H-QVSSHIQVLAR^-OH
    Biosynth
    + Info

    H-QVSSHIQVLAR^-OH

    Peptide H-QVSSHIQVLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Purity:Min. 95%

    Ref: 3D-PP47324

    ne
    To inquire
  • Estrogen Receptor antibody
    Biosynth
    + Info

    Estrogen Receptor antibody

    Estrogen receptor antibody was raised in rabbit using a synthetic peptide derived from the C-terminus of human estrogen receptor, alpha protein as the immunogen.
    Purity:Min. 95%

    Ref: 3D-20R-ER006

    ne
    To inquire
  • Rabbit anti Goat IgG (H + L)
    Biosynth
    + Info

    Rabbit anti Goat IgG (H + L)

    Rabbit anti-Goat IgG (H + L) was raised in rabbit using purified Goat IgG (H&L) as the immunogen.
    Purity:> 95% Based On Sds-Page

    Ref: 3D-41C-CB0501

    2mg
    389.00€
  • H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
    Biosynth
    + Info

    H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

    Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).

    Ref: 3D-PP41946

    ne
    To inquire
  • Rickettsia Typhi Antibody Positive Human Plasma
    Biosynth
    + Info

    Rickettsia Typhi Antibody Positive Human Plasma

    Rickettsia Typhi Antibody Positive Human Plasma is a life science tool for use in IVD applications. Please enquire for more information about Rickettsia Typhi Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-CF5832

    ne
    To inquire
  • CCP Antibody Positive Human Plasma
    Biosynth
    + Info

    CCP Antibody Positive Human Plasma

    CCP Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about CCP Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-AT5942

    ne
    To inquire
  • PR3 antibody positive human plasma
    Biosynth
    + Info

    PR3 antibody positive human plasma

    PR3 antibody positive human plasma is a life science tool for use in IVD applications. Please enquire for more information about PR3 antibody positive human plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-DB5227

    ne
    To inquire
  • VZV IgM Positive Human Plasma
    Biosynth
    + Info

    VZV IgM Positive Human Plasma

    VZV IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about VZV IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-AT5063

    ne
    To inquire
  • Norovirus GII.17 Recombinant P Domain
    Biosynth
    + Info

    Norovirus GII.17 Recombinant P Domain

    Norovirus GII.17 Recombinant P Domain is a life science tool for use in IVD applications. Please enquire for more information about Norovirus GII.17 Recombinant P Domain including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-BU3344

    ne
    To inquire
  • CMV IgM seroconversion panel 6
    Biosynth
    + Info

    CMV IgM seroconversion panel 6

    CMV IgM seroconversion panel 6 is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about CMV IgM seroconversion panel 6 including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-CE8060-PANEL_7

    ne
    To inquire
  • Parvovirus B19 Antibody Negative Human Plasma
    Biosynth
    + Info

    Parvovirus B19 Antibody Negative Human Plasma

    Parvovirus B19 Antibody Negative Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Parvovirus B19 Antibody Negative Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-BV5050

    ne
    To inquire
  • Aclidinium bromide
    Biosynth
    + Info

    Aclidinium bromide

    CAS:
    Muscarinic antagonist; bronchodilator
    Formula:C26H30NO4S2·Br
    Purity:Min. 95 Area-%
    Color and Shape:Purple Powder
    Molecular weight:564.56 g/mol

    Ref: 3D-FA31012

    1g
    1,686.00€
    50mg
    225.00€
    100mg
    338.00€
    250mg
    636.00€
    500mg
    1,003.00€
  • TPO Antibody Negative Human Plasma
    Biosynth
    + Info

    TPO Antibody Negative Human Plasma

    TPO Antibody Negative Human Plasma is a life science tool for use in IVD applications. Please enquire for more information about TPO Antibody Negative Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-AT5130

    ne
    To inquire
  • H-VQIVYKPVDLSK^-OH
    Biosynth
    + Info

    H-VQIVYKPVDLSK^-OH

    Peptide H-VQIVYKPVDLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48796

    ne
    To inquire
  • H-LVEAFGGATK^-OH
    Biosynth
    + Info

    H-LVEAFGGATK^-OH

    Peptide H-LVEAFGGATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42363

    ne
    To inquire
  • H-GQNDTSQTSSPS-Phosphocolamine
    Biosynth
    + Info

    H-GQNDTSQTSSPS-Phosphocolamine

    Peptide H-GQNDTSQTSSPS-Phosphocolamine is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48634

    ne
    To inquire
  • Tachyplesin1-amide
    Biosynth
    + Info

    Tachyplesin1-amide

    Peptide Tachyplesin1-amide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
    Formula:C99H151N35O19S4
    Molecular weight:2,263.76 g/mol

    Ref: 3D-PP47107

    ne
    To inquire
  • EBV EBNA IgG Positive Human Plasma
    Biosynth
    + Info

    EBV EBNA IgG Positive Human Plasma

    EBV EBNA IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about EBV EBNA IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Purity:Min. 95%

    Ref: 3D-BV5204

    ne
    To inquire
  • SEC13 protein (His tag)
    Biosynth
    + Info

    SEC13 protein (His tag)

    Purified recombinant Human SEC13 protein
    Purity:Min. 95%

    Ref: 3D-80R-1766

    100µg
    530.00€
  • H. Pylori IgM Positive Human Plasma
    Biosynth
    + Info

    H. Pylori IgM Positive Human Plasma

    H. Pylori IgM Positive Human Plasma is a life science tool for use in IVD applications. Please enquire for more information about H. Pylori IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-BV5094

    ne
    To inquire
  • LCBiot-IEEQAKTFLDKFNHEAEDLFYQS-NH2
    Biosynth
    + Info

    LCBiot-IEEQAKTFLDKFNHEAEDLFYQS-NH2

    Peptide LCBiot-IEEQAKTFLDKFNHEAEDLFYQS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48842

    ne
    To inquire
  • H-IGMEVTPSGTWLTYTGAIK^-OH
    Biosynth
    + Info

    H-IGMEVTPSGTWLTYTGAIK^-OH

    Peptide H-IGMEVTPSGTWLTYTGAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48906

    ne
    To inquire
  • Mycoplasma Pneumoniae Antigen
    Biosynth
    + Info

    Mycoplasma Pneumoniae Antigen

    Mycoplasma Pneumoniae is a common cause of respiratory illnesses, particularly in children and young adults, and the antigen serves as a crucial component in clinical testing for these infections. By enabling early and accurate detection, it guides appropriate therapeutic interventions and contributes to a better understanding of the epidemiology of Mycoplasma infections. Its application is vital in both clinical settings and research laboratories focused on infectious disease diagnostics and pathogen study.For the preparation of the native antigen, Mycoplasma pneumoniae strain FH is propagated in a defined broth culture system. Following cultivation, the bacterial biomass undergoes detergent-mediated lysis to selectively enrich for the P1-adhesin component, yielding a purified antigenic preparation.Mycoplasma Pneumoniae Antigen is an antigen for use in IVD applications. Please enquire for more information about Mycoplasma Pneumoniae Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-BM6062

    ne
    To inquire
  • H-IYVDDGLISLQVK^-OH
    Biosynth
    + Info

    H-IYVDDGLISLQVK^-OH

    Peptide H-IYVDDGLISLQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41567

    ne
    To inquire
  • Nucleosome Antibody Positive Human Plasma
    Biosynth
    + Info

    Nucleosome Antibody Positive Human Plasma

    Nucleosome Antibody Positive Human Plasma is a life science tool for use in IVD applications. Please enquire for more information about Nucleosome Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.
    Purity:Min. 95%

    Ref: 3D-CF5713

    ne
    To inquire
  • Yersinia Enterocolitica Enterocolitica 0:8 YOP Antigen
    Biosynth
    + Info

    Yersinia Enterocolitica Enterocolitica 0:8 YOP Antigen

    Yersinia Enterocolitica Enterocolitica 0:8 YOP Antigen is a life science tool for use in IVD applications. Please enquire for more information about Yersinia Enterocolitica Enterocolitica 0:8 YOP Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-BM6218

    ne
    To inquire
  • Metolachlor esa
    Biosynth
    + Info

    Metolachlor esa

    CAS:
    Metolachlor esa is a medicinal analog that has shown potential as an anticancer agent. It works by inhibiting kinases, which are enzymes involved in cell signaling pathways that regulate cell growth and division. Metolachlor esa has been found to induce apoptosis (programmed cell death) in cancer cells, making it a promising candidate for the treatment of tumors. In addition, this inhibitor has been detected in urine samples from both human and Chinese populations, suggesting that it may have clinical relevance. Overall, Metolachlor esa represents a promising new class of protein kinase inhibitors with potential for the development of novel cancer therapeutics.
    Formula:C15H23NO5S
    Purity:Min. 95%
    Molecular weight:329.4 g/mol

    Ref: 3D-WGA11809

    ne
    To inquire
  • Chlamydia Pneumoniae IgM Positive Human Plasma
    Biosynth
    + Info

    Chlamydia Pneumoniae IgM Positive Human Plasma

    Chlamydia Pneumoniae IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Chlamydia Pneumoniae IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-AT5135

    ne
    To inquire
  • H. Pylori IgA/IgM Positive Human Plasma
    Biosynth
    + Info

    H. Pylori IgA/IgM Positive Human Plasma

    H. Pylori IgA/IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about H. Pylori IgA/IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-BV5488

    ne
    To inquire
  • H-HEIPVLP^NR-OH
    Biosynth
    + Info

    H-HEIPVLP^NR-OH

    Peptide H-HEIPVLP^NR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47798

    ne
    To inquire
  • Infectious Mononucleosis Antibody Positive Human Plasma
    Biosynth
    + Info

    Infectious Mononucleosis Antibody Positive Human Plasma

    Infectious Mononucleosis Antibody Positive Human Plasma is a life science tool for use in IVD applications. Please enquire for more information about Infectious Mononucleosis Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-AT5118

    ne
    To inquire
  • H-RDYHPRDHTATWGGG-NH2
    Biosynth
    + Info

    H-RDYHPRDHTATWGGG-NH2

    Peptide H-RDYHPRDHTATWGGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44192

    ne
    To inquire
  • tTG/DGP IgG/IgA Positive Human Plasma
    Biosynth
    + Info

    tTG/DGP IgG/IgA Positive Human Plasma

    tTG/DGP IgG/IgA Positive Human Plasma is a life science tool for use in IVD applications. Please enquire for more information about tTG/DGP IgG/IgA Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-CF5367

    ne
    To inquire
  • (Gln53)-Connexin 37 (51-58) (human, mouse, rat)
    Biosynth
    + Info

    (Gln53)-Connexin 37 (51-58) (human, mouse, rat)

    CAS:

    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Formula:C40H59N11O15
    Molecular weight:933.97 g/mol

    Ref: 3D-PP50702

    ne
    To inquire
  • Mycoplasma IgM Positive Human Plasma
    Biosynth
    + Info

    Mycoplasma IgM Positive Human Plasma

    Mycoplasma IgM Positive Human Plasma is a life science tool for use in IVD applications. Please enquire for more information about Mycoplasma IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.

    Ref: 3D-BA5104

    ne
    To inquire
  • H-LLIYY^TSR^-OH
    Biosynth
    + Info

    H-LLIYY^TSR^-OH

    Peptide H-LLIYY^TSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49644

    ne
    To inquire
  • Ac-CAT-NH2
    Biosynth
    + Info

    Ac-CAT-NH2

    Peptide Ac-CAT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46061

    ne
    To inquire