Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,185 products)
- By Biological Target(99,150 products)
- By Pharmacological Effects(6,789 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,764 products)
- Secondary Metabolites(14,307 products)
Found 130581 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SDK1 antibody
<p>SDK1 antibody was raised in rabbit using the middle region of SDK1 as the immunogen</p>Purity:Min. 95%Human IL1 α ELISA kit
<p>ELISA kit for the detection of IL1 alpha in the research laboratory</p>Purity:Min. 95%HRP-IgG Conjugation Kit
<p>HRP-IgG conjugation kit utilizes a novel chemistry to generate highly reproducible IgG-HRP conjugates with a simple procedure. The resulting conjugates have been shown to be extremely stable, retaining 100% activity after storage for 60 days at 37º C with concentrations as low as 0.5 μg/mL.Features:<br><br>Liquid-based reagents-No reconstitution, just Mix and Go.<br>Completely scaleable – Conjugate anywhere from 0.1 to 1 gram IgG per reaction.<br>Supplies sufficient activated HRP to conjugate all IgG at a 4:1 HRP:IgG ratio.<br>Highly efficient HRP incorporation – conjugate purification not usually necessary.<br>Customize the HRP:IgG ratio to create optimized conjugates for different applications.</p>Purity:Min. 95%Gliadin screen ELISA kit
<p>ELISA kit for the detection of Gliadin screen in the research laboratory</p>Purity:Min. 95%Phosphatidyl Serine IgG/IgM ELISA kit
<p>ELISA kit for the detection of Phosphatidyl Serine IgG/IgM in the research laboratory</p>Purity:Min. 95%Rat Thyroxine ELISA kit
<p>ELISA Kit for detection of Thyroxine in the research laboratory</p>Purity:Min. 95%CD80 antibody
<p>The CD80 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets CD80, a protein involved in immune responses and cell signaling. This antibody can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting.</p>Gliadin IgG ELISA kit
<p>ELISA kit for the detection of Gliadin IgG in the research laboratory</p>Purity:Min. 95%Mouse Neurotrophin 3 ELISA Kit
<p>ELISA kit for detection of Neurotrophin3 in the research laboratory</p>Purity:Min. 95%MYBPH antibody
<p>MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP</p>Purity:Min. 95%Chlamydia pneumoniae IgG ELISA kit
<p>ELISA kit for the detection of Chlamydia pneumoniae IgG in the research laboratory</p>Purity:Min. 95%Testosterone ELISA Kit
<p>ELISA kit for detection of Testosterone in the research laboratory</p>Purity:Min. 95%Tetanus toxin antibody
<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>Purity:>92% By Gel Electrophoresis And Gel ScanningIgG1 κ Isotype Control Fc fusion protein
<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein</p>Purity:Min. 95%MEF2A antibody
<p>The MEF2A antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and inhibits the activity of MEF2A, a transcription factor involved in various cellular processes. This polyclonal antibody is highly specific and can be used for a wide range of applications in research laboratories.</p>Purity:Min. 95%
