Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,118 products)
- By Biological Target(99,156 products)
- By Pharmacological Effects(6,788 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,748 products)
- Secondary Metabolites(14,233 products)
Found 130579 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-NAPYLPSCL-OH
<p>Peptide H-NAPYLPSCL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CLHFTPKDWSKRGKW-OH
<p>Peptide H-CLHFTPKDWSKRGKW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGLSTGWTQLSK-OH
<p>Peptide H-SGLSTGWTQLSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QRPIFIITEYMANGC-OH
<p>Peptide H-QRPIFIITEYMANGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SYPGLTSYLVR-OH
<p>Peptide H-SYPGLTSYLVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HTLNQIDEVK-OH
<p>Peptide H-HTLNQIDEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPGHKARVL-OH
<p>Peptide H-GPGHKARVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILLSELSRRRIR-OH
<p>Peptide H-ILLSELSRRRIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLYVQASGRVTVSTRR-OH
<p>Peptide H-SLYVQASGRVTVSTRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLEQELETITIPDVYGAK-OH
<p>Peptide H-FLEQELETITIPDVYGAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YSSDYFQAPSDYR-OH
<p>Peptide H-YSSDYFQAPSDYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LY 354740
CAS:<p>Metabotropic glutamate receptor (mGluR2/3) agonist</p>Formula:C8H11NO4Purity:Min. 95%Molecular weight:185.18 g/molH-PVQL-OH
<p>Peptide H-PVQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AHVQVVDSNGNR-OH
<p>Peptide H-AHVQVVDSNGNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FEDENFILK-OH
<p>Peptide H-FEDENFILK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIYRYGGL-OH
<p>Peptide H-SIYRYGGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTYRHKVVK-OH
<p>Peptide H-LTYRHKVVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FASIR-OH
<p>Peptide H-FASIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CDYKDDDDK-OH
<p>Peptide H-CDYKDDDDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IVQL-OH
<p>Peptide H-IVQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLTWASR-OH
<p>Peptide H-YLTWASR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ISVYYNEASSHK-OH
<p>Peptide H-ISVYYNEASSHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LMKNMDPLNDNV-OH
<p>Peptide H-LMKNMDPLNDNV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLEWVAEIR-OH
<p>Peptide H-GLEWVAEIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KALARQLGVAA-OH
<p>Peptide H-KALARQLGVAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLFNTIAVL-OH
<p>Peptide H-SLFNTIAVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLPDLCTEL-OH
<p>Peptide H-KLPDLCTEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AETSELHTSLK-OH
<p>Peptide H-AETSELHTSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DDFR-OH
<p>Peptide H-DDFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPQVPLRPMTY-OH
<p>Peptide H-RPQVPLRPMTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALWGQDVTSV-OH
<p>Peptide H-ALWGQDVTSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LADLQVPR-OH
<p>Peptide H-LADLQVPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRVYIHPFHL-OH
<p>Negative control peptide for OVA (257-264). This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Color and Shape:PowderH-IWYINCFGCETHAML-OH
<p>Peptide H-IWYINCFGCETHAML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLPFQQFGR-OH
<p>Peptide H-FLPFQQFGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CTASLPQEDMEPNATPTTPEA-OH
<p>Peptide H-CTASLPQEDMEPNATPTTPEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>6-Methyl-5-nitrouracil
CAS:Formula:C5H5N3O4Purity:>95.0%(T)(HPLC)Color and Shape:Light orange to Yellow to Green powder to crystalMolecular weight:171.11H-AGANLFELENFVAR-OH
<p>Peptide H-AGANLFELENFVAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKKKKKKK-OH
<p>Peptide H-KKKKKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH
<p>Peptide H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VMAPRTLL-OH
<p>Peptide H-VMAPRTLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CKKKKKKC-OH
<p>Peptide H-CKKKKKKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TEKLWVTVYYGVPVWREATT-OH
<p>Peptide H-TEKLWVTVYYGVPVWREATT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EALYLVCGERGFFYT-OH
<p>Peptide H-EALYLVCGERGFFYT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IAIVMVTIM-OH
<p>Peptide H-IAIVMVTIM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STGGKAPRK-OH
<p>Peptide H-STGGKAPRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LADGGATNQGR-OH
<p>Peptide H-LADGGATNQGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLQEINAYIGHSVEK-OH
<p>Peptide H-NLQEINAYIGHSVEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLSVNDLPVGR-OH
<p>Peptide H-HLSVNDLPVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPPSSLLR-OH
<p>Peptide H-DPPSSLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSNNNPTTIMRPPVAQN-OH
<p>Peptide H-LSNNNPTTIMRPPVAQN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APVLFFDR-OH
<p>Peptide H-APVLFFDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSEPVYIQPISTRSL-OH
<p>Peptide H-NSEPVYIQPISTRSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CDITQVMSKLDRRSQL-OH
<p>Peptide H-CDITQVMSKLDRRSQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVGARGVGK-OH
<p>Peptide H-VVGARGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGSLQPLALEGSLQKRG-OH
<p>Peptide H-AGSLQPLALEGSLQKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRRR-OH
<p>Peptide H-RRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLL-OH
<p>Peptide H-LLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GKWERPFEVK-OH
<p>Peptide H-GKWERPFEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLVVHEK-OH
<p>Peptide H-TLVVHEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FRDYVDRFYKTLRAE-OH
<p>Peptide H-FRDYVDRFYKTLRAE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GYDTKQEDG-OH
<p>Peptide H-GYDTKQEDG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FYAEATPML-OH
<p>Peptide H-FYAEATPML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CVGGVV-OH
<p>Peptide H-CVGGVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CGDRPFDETTYEETED-OH
<p>Peptide H-CGDRPFDETTYEETED-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLTPRCNTAWN-OH
<p>Peptide H-SLTPRCNTAWN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PEPTAPPEE-OH
<p>Peptide H-PEPTAPPEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGFSSVSVSR-OH
<p>Peptide H-SGFSSVSVSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLDEGKQSL-OH
<p>Peptide H-LLDEGKQSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KILLARLFLYALALL-OH
<p>Peptide H-KILLARLFLYALALL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPMTYKGAL-OH
<p>Peptide H-RPMTYKGAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSLNLQKDEPNGRASDTAGQ-OH
<p>Peptide H-TSLNLQKDEPNGRASDTAGQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YISWCLWW-OH
<p>Peptide H-YISWCLWW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NKPGVYTK-OH
<p>Peptide H-NKPGVYTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Isoamyl n-Octanoate (contains 2-Methylbutyl n-Octanoate)
CAS:Formula:C13H26O2Purity:min. 97.0 %(total of isomer)(GC)Color and Shape:Colorless to Light yellow clear liquidMolecular weight:214.35H-SFERFEIFPK-OH
<p>Peptide H-SFERFEIFPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VMAPQSLLL-OH
<p>Peptide H-VMAPQSLLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RHPDYSVVLLLR-OH
<p>Peptide H-RHPDYSVVLLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CREAGRKAC-OH
<p>Peptide H-CREAGRKAC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTEHDTLLY-OH
<p>Peptide H-VTEHDTLLY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NTRTSINIGPGQVFY-OH
<p>Peptide H-NTRTSINIGPGQVFY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AEWEQK-OH
<p>Peptide H-AEWEQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLKEKGGL-OH
<p>Peptide H-FLKEKGGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YYQGSCYIL-OH
<p>Peptide H-YYQGSCYIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSSASLNIR-OH
<p>Peptide H-LSSASLNIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IAFTSEHSHFSLK-OH
<p>Peptide H-IAFTSEHSHFSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRQDILDLWIY-OH
<p>Peptide H-RRQDILDLWIY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGDANPALQK-OH
<p>Peptide H-VGDANPALQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKRNRTLTV-OH
<p>Peptide H-KKRNRTLTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MGLKFRQL-OH
<p>Peptide H-MGLKFRQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNHAVLAVGYGEK-OH
<p>Peptide H-VNHAVLAVGYGEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGPRGENEGPDS-OH
<p>Peptide H-YGPRGENEGPDS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PSDRPFKQRRSFADC-OH
<p>Peptide H-PSDRPFKQRRSFADC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LFLRATTEL-OH
<p>Peptide H-LFLRATTEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPKLHFYYL-OH
<p>Peptide H-SPKLHFYYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILDSFDPLV-OH
<p>Peptide H-ILDSFDPLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KYRLKHIVW-OH
<p>Peptide H-KYRLKHIVW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KELKRQYEKKLRQ-OH
<p>Peptide H-KELKRQYEKKLRQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SESSTILVV-OH
<p>Peptide H-SESSTILVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPLSMVGPSQGRSPSYAS-OH
<p>Peptide H-DPLSMVGPSQGRSPSYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

