Biochemicals and Reagents

<p>UBE4A antibody was raised using a synthetic peptide corresponding to a region with amino acids QYAPQLAEALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDTYR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LENG4 antibody, catalog no. 70R-1902</p>

<p>The CDCP1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of monoclonal antibodies and is used for various applications such as immunoassays, cell cytotoxicity studies, and research in the field of anticancer agents.</p>

<p>Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.</p>

<p>Rabbit polyclonal MAST3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ENDOG antibody, catalog no. 70R-5315</p>

<p>SEMA4B antibody was raised using the N terminal of SEMA4B corresponding to a region with amino acids KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS</p>

<p>The ACTA1 antibody is a polyclonal antibody that specifically targets the ACTA1 protein. This protein plays a crucial role in muscle contraction and is found predominantly in skeletal muscle fibers. The ACTA1 antibody can be used for various applications, including immunohistochemistry, western blotting, and ELISA. It has been validated for use in human serum samples and has shown high specificity and sensitivity.</p>

<p>CREG2 antibody was raised using the N terminal of CREG2 corresponding to a region with amino acids VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAH</p>

<p>Rabbit polyclonal IRF3 antibody (Ser386)</p>

<p>Affinity purified Rabbit polyclonal GNAT2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GP2 antibody, catalog no. 70R-6818</p>

<p>Rabbit polyclonal Parkin antibody (Ser131)</p>

<p>Rabbit polyclonal TXN antibody</p>

<p>Recombinant Human CYTH1 protein with His tag</p>

<p>Rabbit polyclonal MAS1L antibody</p>

<p>LSM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDE</p>

<p>Met antibody is a polyclonal antibody that specifically targets the tyrosine kinase receptor known as c-Met. This antibody has neutralizing properties, meaning it can inhibit the activity of c-Met and its downstream signaling pathways. By binding to the protein complex formed by c-Met and its ligand, this antibody prevents the activation of various cellular processes involved in cell growth, survival, migration, and invasion.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAOA antibody, catalog no. 70R-2465</p>

<p>SHANK1a antibody was raised in rabbit using residues [SGPIYPGLFDIRSS] of the C terminus of the Shank1a protein as the immunogen.</p>

<p>The ACSS2 antibody is a colony-stimulating antibody that activates the production of specific proteins in human serum. It is widely used in the field of Life Sciences for various research purposes. This monoclonal antibody specifically targets c-myc, a protein involved in cell growth and proliferation. By binding to c-myc, the ACSS2 antibody can modulate its activity and regulate cellular processes. Additionally, this antibody has been shown to interact with other proteins such as alpha-fetoprotein (AFP), interferon-gamma (IFN-gamma), glutamate receptors, and phosphatase enzymes. Its acidic nature allows it to effectively target fatty acids and participate in metabolic pathways related to lipid metabolism. With its wide range of applications, the ACSS2 antibody is an essential tool for researchers in the Life Sciences field.</p>

<p>ZHX3 antibody was raised in rabbit using the middle region of ZHX3 as the immunogen</p>

<p>Region of IL9 protein corresponding to amino acids MQRCSTTWGI RDTNYLIENL KDDPPSKCSC SGNVTSCLCL SVPTDDCTTP CYREGLLQLT NATQKSRLLP VFHRVKRIVE VLKNITCPSF SCEKPCNQTM AGNTMSFLKS LLGTFQKTEM QRQKSRP.</p>

<p>Rabbit polyclonal TACC1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC60 antibody, catalog no. 70R-4198</p>

<p>ALPHA FACTOR SIGNALING PEPTIDE</p>

<p>C21ORF56 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVRPKKVCFSESSLPTGDRTRRSYYLNEIQSFAGAEKDARVVGEIAFQLD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NR6A1 antibody, catalog no. 70R-2014</p>

<p>ABCD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TGFBI antibody, catalog no. 70R-1826</p>

<p>GINS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA</p>

<p>Purified Polyclonal KCNAB3 antibody</p>

<p>The NDKA antibody is a highly specific monoclonal antibody that targets alpha-fetoprotein (AFP). It has been shown to bind to AFP with high affinity and specificity, making it an ideal tool for detecting and quantifying AFP levels in various biological samples. The NDKA antibody can be used in immunoassays such as ELISA or Western blotting to study the expression and function of AFP in different physiological and pathological conditions.</p>

<p>The Tau antibody is a mouse monoclonal antibody that is widely used in Life Sciences research. It specifically binds to the peptide sequence of Tau protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. This antibody has been extensively studied and validated for its high affinity and specificity towards Tau protein.</p>

<p>Purified Polyclonal p15 INK4b antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MTRR antibody, catalog no. 70R-4020</p>

<p>Rabbit polyclonal RNF40 antibody</p>

<p>Purified recombinant Human GGPS1 protein</p>

<p>Rabbit polyclonal TGDS antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF40 antibody, catalog no. 70R-1057</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GYS2 antibody, catalog no. 70R-2872</p>

<p>The TIM3 antibody is a monoclonal antibody that specifically targets the TIM3 molecule, which is found in the nucleus of cells. This antibody is widely used in Life Sciences research for various applications. It has been shown to have cytotoxic effects on cells expressing high levels of TIM3, making it a valuable tool for studying its function and potential therapeutic applications. Additionally, the TIM3 antibody has been used in studies related to thrombocytopenia, anti-icos antibodies, anti-mesothelin antibodies, urokinase plasminogen activator, and β-catenin. Its high specificity and affinity make it an essential component in many research projects within the field of molecular biology and immunology.</p>

<p>Mouse monoclonal HAGHL antibody</p>

<p>Rabbit polyclonal THUMPD3 antibody</p>

<p>Purified Polyclonal CDKL2 antibody</p>

<p>Rabbit Polyclonal EGFR antibody (Thr693)</p>

<p>MTMR2 antibody was raised in Rabbit using Human MTMR2 as the immunogen</p>

<p>EEF1B2 antibody was raised using the middle region of EEF1B2 corresponding to a region with amino acids VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREE</p>

<p>Sulfadiazine (USP grade powder) chemical reference substance</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBBP6 antibody, catalog no. 70R-5583</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of APOL5 antibody, catalog no. 70R-9610</p>

<p>Region of BD4 protein corresponding to amino acids EFELDRICGY GTARCRKKCR SQEYRIGRCP NTYACCLRKW DESLLNRTKP.</p>

<p>hCG alpha antibody was raised in mouse using human urine hCG.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of 5730409E04Rik antibody, catalog no. 70R-9213</p>

<p>AK3 antibody was raised using the N terminal of AK3 corresponding to a region with amino acids MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT</p>

<p>Affinity purified Rabbit polyclonal alpha 2 Antiplasmin antibody</p>

<p>LRP8 antibody was raised using the middle region of LRP8 corresponding to a region with amino acids ATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGV</p>

<p>Rabbit polyclonal SLC6A13 antibody</p>

<p>25-412 amino acids: MGSSHHHHHH SSGLVPRGSH MLHTIYQSVE LPETHQMLLQ TCRDFAEKEL FPIAAQVDKE HLFPAAQVKK MGGLGLLAMD VPEELGGAGL DYLAYAIAME EISRGCASTG VIMSVNNSLY LGPILKFGSK EQKQAWVTPF TSGDKIGCFA LSEPGNGSDA GAASTTARAE GDSWVLNGTK AWITNAWEAS AAVVFASTDR ALQNKSISAF LVPMPTPGLT LGKKEDKLGI RGSSTANLIF EDCRIPKDSI LGEPGMGFKI AMQTLDMGRI GIASQALGIA QTALDCAVNY AENRMAFGAP LTKLQVIQFK LADMALALES ARLLTWRAAM LKDNKKPFIK EAAMAKLAAS EAATAISHQA IQILGGMGYV TEMPAERHYR DARITEIYEG TSEIQRLVIA GHLLRSYRS</p>

<p>Rabbit polyclonal MKL1 antibody</p>

<p>Rabbit polyclonal Collagen I alpha 2 antibody</p>

<p>Rabbit polyclonal Spa17 antibody</p>

<p>The c-Jun antibody is a specific antibody that targets the protein complex known as c-Jun. This complex plays a crucial role in various cellular processes, including cell growth and differentiation. The c-Jun antibody specifically recognizes the activated form of c-Jun and can be used for research purposes in the field of life sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SEMA6D antibody, catalog no. 70R-7127</p>

<p>FTCD/58K-Golgi Protein Monoclonal Antibody</p>

<p>SEPT4 (septin-4)  antibody was raised in rabbit using the N terminal of SEPT4 as the immunogen</p>

<p>Rabbit polyclonal KRAS antibody (FITC)</p>

<p>Rabbit polyclonal Ornithine decarboxylase antibody (biotin)</p>

<p>Rabbit polyclonal GRID1 antibody</p>

<p>Thrombin antibody was raised in sheep using Thrombin prepared from purified bovine Prothrombin as the immunogen.</p>

<p>CD69 antibody (Azide free) was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.</p>

<p>The EPHB4 antibody is a monoclonal antibody that specifically binds to the EPHB4 receptor, a human protein involved in various cellular processes. This antibody is produced by hybridoma cells and has been extensively studied in the field of Life Sciences. It has shown high affinity and specificity for its target and can be used in various applications such as receptor binding studies, immunoassays, and therapeutic interventions.</p>

<p>AARS antibody was raised in Rabbit using Human AARS as the immunogen</p>

<p>The ENO1 antibody is a specific monoclonal antibody that targets the c-myc protein kinase. It has been shown to inhibit the growth factor signaling pathway and reduce microvessel density in monolayer cultures of MCF-7 cells. This antibody can be used for various applications, including immunohistochemistry, immunofluorescence, and Western blotting. It is highly sensitive and specific, making it an ideal tool for studying the expression and localization of ENO1 in different cell types. Additionally, this antibody has been used to detect autoantibodies against ENO1 in certain diseases, making it a valuable tool for diagnostic purposes. The ENO1 antibody is supplied as a polyclonal antibody and can be used with saponin or TGF-beta for enhanced staining results.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LETM2 antibody, catalog no. 70R-3573</p>

<p>ANAPC4 antibody was raised in Rabbit using Human ANAPC4 as the immunogen</p>

<p>PHGDH antibody was raised using the middle region of PHGDH corresponding to a region with amino acids SLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PBLD antibody, catalog no. 70R-4307</p>

<p>Purified Rabbit polyclonal PAK1/2/3 antibody</p>

<p>The IGF2BP3 antibody is a powerful tool in the field of Life Sciences. It belongs to the class of monoclonal antibodies and has shown great potential as an antiviral agent. This antibody specifically targets insulin-like growth factor 2 mRNA-binding protein 3 (IGF2BP3), a key regulator of cell growth and proliferation.</p>

<p>Mouse monoclonal PLDN antibody</p>

<p>Rabbit polyclonal Tip31 antibody</p>

<p>TM7SF2 antibody was raised using the N terminal of TM7SF2 corresponding to a region with amino acids LAARSGPARLLGPPASLPGLEVLWSPRALLLWLAWLGLQAALYLLPARKV</p>

<p>Rabbit polyclonal GPR174 antibody</p>

<p>The Nucleophosmin antibody is a highly reactive antibody that specifically targets nucleophosmin, a protein found in human serum. This antibody has been extensively studied and shown to have various applications in life sciences research. It can be used for the detection of nucleophosmin in different biological samples and has been validated for use in techniques such as Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HP1BP3 antibody, catalog no. 70R-3142</p>

<p>PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids HWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQ</p>

<p>HIV1 antibody (HTLV3) (biotin) was raised in goat using human isolate as the immunogen.</p>

<p>Rabbit polyclonal PPP1CB antibody</p>

<p>The PAX3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the PAX3 antigen, which plays a crucial role in various biological processes. This antibody has shown promising antiviral properties by interfering with the replication of certain viruses. Additionally, it has been found to enhance the production of interferon, an important component of the immune response against viral infections.</p>

<p>C2ORF42 antibody was raised using the N terminal Of C2Orf42 corresponding to a region with amino acids EPNSLRTKVPAFLSDLGKATLRGIRKCPRCGTYNGTRGLSCKNKTCGTIF</p>

<p>RNF165 antibody was raised using the middle region of RNF165 corresponding to a region with amino acids SSTQMVVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLG</p>

<p>UPB1 antibody was raised using the middle region of UPB1 corresponding to a region with amino acids AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAV</p>

<p>Purified recombinant ApoH protein</p>

<p>Purified recombinant Human DNAJB6 protein</p>

<p>OR1S1 antibody was raised in rabbit using the C terminal of OR1S1 as the immunogen</p>

<p>The PKNOX1 antibody is a highly specialized monoclonal antibody that targets the PKNOX1 protein. This protein is involved in various cellular processes, including fibrinogen production, cell antigen presentation, and amyloid plaque formation. Additionally, PKNOX1 plays a crucial role as a growth factor and phosphatase regulator.</p>

<p>RAD antibody is a polyclonal antibody that specifically targets vascular endothelial growth factor (VEGF). It is widely used in life sciences research to study the role of VEGF in angiogenesis and tumor growth. This antibody binds to activated VEGF receptors and inhibits their signaling, thereby blocking the growth and proliferation of endothelial cells. RAD antibody also shows cross-reactivity with other growth factors such as erythropoietin and epidermal growth factor. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its high specificity and affinity, RAD antibody is a valuable tool for investigating the mechanisms of angiogenesis and developing antiangiogenic therapies.</p>

<p>NPTX2 antibody was raised in rabbit using the N terminal of NPTX2 as the immunogen</p>

<p>TUBA1C antibody was raised in rabbit using the C terminal of TUBA1C as the immunogen</p>