Biochemicals and Reagents

<p>Benzodiazepine antibody was raised in mouse using benzodiazepine as the immunogen.</p>

<p>Hexestrol p-OH Conjugate for use in immunoassays</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>Affinity purified Rabbit polyclonal TR alpha antibody</p>

<p>PSME1 antibody was raised using the middle region of PSME1 corresponding to a region with amino acids KEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEI</p>

<p>Rabbit polyclonal Peroxiredoxin 1 antibody (FITC)</p>

<p>Rabbit polyclonal WBSCR17 antibody</p>

<p>Rabbit polyclonal GATA4 antibody (Ser262)</p>

<p>Junctophilin 3 antibody was raised using the N terminal of JPH3 corresponding to a region with amino acids SSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLG</p>

<p>The MAOA antibody is a highly specific and potent inhibitor of the enzyme monoamine oxidase A (MAOA). This antibody binds to the active site of MAOA, preventing its enzymatic activity. MAOA plays a crucial role in the metabolism of histamine, serotonin, and other neurotransmitters, making it an important target for therapeutic interventions. The MAOA antibody has been extensively studied in various research areas, including neuroscience, oncology, and immunology.</p>

<p>Purified Polyclonal PIGX antibody</p>

<p>CYP46A1 antibody was raised using the C terminal of CYP46A1 corresponding to a region with amino acids YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF585B antibody, catalog no. 70R-8118</p>

<p>The EDG5 antibody is a polyclonal antibody that specifically targets the EDG5 receptor. This receptor plays a crucial role in various biological processes, including cell proliferation, migration, and survival. The EDG5 antibody has been shown to effectively block the binding of its ligands and inhibit downstream signaling pathways.</p>

<p>MAPK15 antibody was raised using the middle region of MAPK15 corresponding to a region with amino acids GHDPAEHESPRAAKNVPRQNSAPLLQTALLGNGERPPGAKEAPPLTLSLV</p>

<p>The HDAC5 antibody is a highly specialized product used in Life Sciences research. It is an antibody that specifically targets atypical hemolytic autoantibodies. This antibody has neutralizing properties, meaning it can inhibit the activity of these autoantibodies, preventing them from causing damage to red blood cells. The HDAC5 antibody is produced using state-of-the-art techniques and has been extensively tested for its efficacy and specificity.</p>

<p>The PANX1 antibody is a powerful tool in the field of Life Sciences. It belongs to the class of antibodies known as globulins and has been extensively studied for its role in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their specific needs.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRMT11 antibody, catalog no. 70R-2110</p>

<p>Nurim antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGW</p>

<p>PECAM1 protein is a human serum protein that plays a crucial role in various biological processes. It is commonly used as a target for monoclonal antibody research and has been extensively studied in the field of Life Sciences. PECAM1 protein is known to be activated by TNF-α and can interact with other proteins such as fibrinogen, chemokines, and interleukin-6.</p>

<p>ZNF397 antibody was raised in rabbit using the middle region of ZNF397 as the immunogen</p>

<p>Rabbit polyclonal GFAP antibody (Prediluted for IHC)</p>

<p>ENO2 antibody was raised in rabbit using the N terminal of ENO2 as the immunogen</p>

<p>Rabbit polyclonal AZI2 antibody</p>

<p>Purified Polyclonal IFNGR1 antibody</p>

<p>CLDN3 antibody was raised in Rabbit using Human CLDN3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HNF4A antibody, catalog no. 70R-2034</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MTHFS antibody, catalog no. 70R-3776</p>

<p>The AKR1C3 antibody is a reactive antibody used in Life Sciences research. It can be used as both a polyclonal and monoclonal antibody. This antibody is commonly used to detect autoantibodies in human serum samples. It specifically targets AKR1C3, an enzyme that plays a role in hormone metabolism and has been implicated in various diseases, including cancer.</p>

<p>Rabbit polyclonal RND2 antibody</p>

<p>MMP26 antibody was raised in rabbit using the C terminal of MMP26 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LAMP3 antibody, catalog no. 70R-7455</p>

<p>MTIF3 antibody was raised in Rabbit using Human MTIF3 as the immunogen</p>

<p>SUVN-502 dimesylate is a pharmaceutical combination that contains the acetylcholinesterase inhibitor donepezil and the 5-HT6 receptor antagonist pruvincamine. It is used for the treatment of dementia symptoms, with an effective dose of 40 mg/day. SUVN-502 dimesylate has a dual mechanism of action by inhibiting acetylcholinesterase and antagonizing 5-HT6 receptors. The 5-HT6 receptor is involved in memory consolidation and learning, as well as cognition. This drug may be useful in treating people who have moderate to severe dementia, particularly if they are already taking donepezil or other acetylcholinesterase inhibitors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RTN1 antibody, catalog no. 70R-6578</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VIM antibody, catalog no. 70R-2952</p>

<p>PTX3 antibody was raised using the N terminal of PTX3 corresponding to a region with amino acids RMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDEL</p>

<p>The SOCS2 antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It specifically targets fatty acid, e-cadherin, and insulin antibodies. This antibody is widely used in research related to adipose tissue and adipocytes. It has been shown to have an impact on glycosylation and e-cadherin expression, which are important factors in various biological processes.</p>

<p>MGMT protein is a drug antibody that plays a crucial role in DNA repair and protection against alkylating agents. It is involved in the removal of alkyl groups from the O6 position of guanine, preventing the formation of DNA adducts and subsequent mutations. MGMT protein can be detected using polymerase chain reaction (PCR) or immunohistochemistry techniques. It has been shown to interact with lectins and carbonic anhydrases, suggesting its involvement in glycosylation processes and cellular metabolism. Activated MGMT protein undergoes glycan modifications, which make it more reactive and capable of binding to anti-ganglioside antibodies. In Life Sciences research, recombinant MGMT proteins are commonly used as antigens for studying immune responses and developing therapeutic strategies. Additionally, MGMT protein has been found to have natriuretic and cytotoxic effects on human hepatocytes, indicating its potential role in liver physiology and disease.</p>

<p>MPG antibody was raised in Rabbit using Human MPG as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1704 antibody, catalog no. 70R-4073</p>

<p>5-Methyl-N-(1-methyl-1H-pyrazol-3-yl)-1-[[3-(trifluoromethyl)phenyl]methyl]-1H-imidazole-4-carboxamide is a chemical compound known for its role as a potent inhibitor. This compound is synthetically derived, designed to interfere with specific molecular pathways by binding to targeted active sites, which in turn inhibits enzymatic functions. Its mechanism of action includes the disruption of particular cellular signaling processes, making it a valuable tool in biochemical research.</p>

<p>GORASP1 antibody was raised using the N terminal of GORASP1 corresponding to a region with amino acids PYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEV</p>

<p>Granzyme K antibody was raised using a synthetic peptide corresponding to a region with amino acids LRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPF</p>

<p>LYZL6 antibody was raised in Rabbit using Human LYZL6 as the immunogen</p>

<p>Purified recombinant CKS1B protein (His tag)</p>

<p>CCL16 antibody was raised in rabbit using the N terminal of CCL16 as the immunogen</p>

<p>SNAI1 antibody was raised in rabbit using the N terminal of SNAI1 as the immunogen</p>

<p>Cytokeratin 13 antibody was raised using the C terminal of KRT13 corresponding to a region with amino acids EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP</p>

<p>MEIS3 antibody was raised in rabbit using the middle region of MEIS3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MKRN2 antibody, catalog no. 70R-2130</p>

<p>FK960 is a five-membered, cyclic molecule that binds to the target enzyme nicotinic acetylcholine receptor in the brain. It inhibits cholinesterase and blocks acetylcholine from binding to its receptors. This inhibition leads to an increase in acetylcholine levels in the brain and a decrease in memory loss. FK960 has been shown to be effective against neurodegenerative diseases such as Alzheimer's disease. The low molecular weight of FK960 makes it orally bioavailable and able to cross the blood-brain barrier, which is difficult for most drugs. FK960 also has an inhibitory effect on c1-6 alkyl groups found in the peripheral nervous system, which may be responsible for its effects on Alzheimer's disease.</p>

<p>AKAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGF</p>

<p>Rabbit polyclonal PSG4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MRPL37 antibody, catalog no. 70R-2424</p>

<p>Na, K ATPase antibody was raised in mouse using purified rat kidney Na, K ATPase as the immunogen.</p>

<p>BAG2 antibody was raised using the C terminal of BAG2 corresponding to a region with amino acids VDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSK</p>

<p>Region of FGF5 protein corresponding to amino acids MAWAHGEKRL APKGQPGPAA TDRNPIGSSS RQSSSSAMSS SSASSSPAAS LGSQGSGLEQ SSFQWSPSGR RTGSLYCRVG IGFHLQIYPD GKVNGSHEAN MLSVLEIFAV SQGIVGIRGV FSNKFLAMSK KGKLHASAKF TDDCKFRERF QENSYNTYAS AIHRTEKTGR EWYVALNKRG KAKRGCSPRV KPQHISTHFL PRFKQSEQPE LSFTVTVPEK KNPPSPIKSK IPLSAPRKNT NSVKYRLKFR FG.</p>

<p>MTR antibody was raised using the C terminal of MTR corresponding to a region with amino acids GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL</p>

<p>Goat anti-monkey IgG was raised in goat using monkey IgG chain as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLCC1 antibody, catalog no. 70R-1789</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LARP1 antibody, catalog no. 70R-4916</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>Sphingosine is a long-chain fatty acid that is naturally found in the human body. It has been shown to have a role in regulating cellular metabolism and apoptosis, as well as inflammatory responses. Sphingosine is metabolized through the action of hydrochloric acid and hydrogen chloride to form sphinganine, which can then be converted into other metabolites. The metabolism of sphingosine is an important factor for determining its effects on the body. Chronic exposure to sphingosine may result in an accumulation of metabolites in the body, which may lead to metabolic profiles that are similar to those seen in various diseases such as cancer and inflammatory diseases.</p>

<p>BDH1 antibody was raised in Mouse using a purified recombinant fragment of human BDH1 expressed in E. coli as the immunogen.</p>

<p>GTPBP3 antibody was raised in Rabbit using Human GTPBP3 as the immunogen</p>

<p>Goat IgG protein is a versatile immunoglobulin that has various applications in the field of Life Sciences. It can be used as a primary or secondary antibody for immunohistochemistry, Western blotting, ELISA, and other immunoassays. Goat IgG protein is highly specific and exhibits strong binding affinity to a wide range of target antigens.</p>

<p>Rabbit polyclonal Mt13 antibody</p>

<p>FIS1 antibody was raised in Rabbit using Human FIS1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF165 antibody, catalog no. 70R-2743</p>

<p>Canine Factor VIII antigen Matched Pair antibody Set for ELISA</p>

<p>Goat anti-human IgG (H+L) (HRP) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>The CYP2S1 antibody is a highly specialized insulin antibody that belongs to the group of polyclonal antibodies. It is specifically designed to target and neutralize tumor necrosis factor-alpha (TNF-α), a growth factor involved in various inflammatory processes. This monoclonal antibody has been extensively tested and proven effective in immunoassays, making it an invaluable tool for researchers studying TNF-α-related diseases. Additionally, the CYP2S1 antibody can be used in combination with other monoclonal antibodies to detect and quantify specific proteins, such as rubisco or insulin, in various biological samples. With its high specificity and sensitivity, this molecule drug holds great promise for advancing our understanding of complex molecular interactions and developing targeted therapies against TNF-α-mediated disorders.</p>

<p>BRCA1 antibody was raised in Rabbit using Human BRCA1 as the immunogen</p>

<p>Region of IL21 protein corresponding to amino acids MHKSSPQGPD RLLIRLRHLI DIVEQLKIYE NDLDPELLSA PQDVKGHCEH AAFACFQKAK LKPSNPGNNK TFIIDLVAQL RRRLPARRGG KKQKHIAKCP SCDSYEKRTP KEFLERLKWL LQKMIHQHLS.</p>

<p>The GPR17 antibody is a crucial tool in Life Sciences for various applications. It is specifically designed to target G-protein coupled receptor 17 (GPR17), which plays a significant role in cellular signaling pathways. This antibody can be used for diagnostic purposes, as it serves as a valuable biomarker for specific diseases and conditions. Additionally, it can act as an inhibitor, blocking the activity of GPR17 and modulating its effects on cellular processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNAB1 antibody, catalog no. 70R-5041</p>

<p>Affinity purified Rabbit polyclonal GMF beta antibody</p>

<p>Purified Polyclonal HIF3 alpha antibody</p>

<p>The TRIB3 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It specifically targets and binds to the growth factor TRIB3, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be an effective tool for research purposes.</p>

<p>Lrp8 antibody was raised in rabbit using the middle region of Lrp8 as the immunogen</p>

<p>SLC16A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTIN</p>

<p>Mouse monoclonal TAL1 antibody</p>

<p>Mouse monoclonal TUBB4 antibody</p>

<p>KCTD11 antibody was raised using the N terminal of KCTD11 corresponding to a region with amino acids RLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASQGTPAPTAALL</p>

<p>FUS antibody was raised using the N terminal of FUS corresponding to a region with amino acids MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGY</p>

<p>TIPIN antibody was raised in rabbit using the middle region of TIPIN as the immunogen</p>

<p>ESRRA antibody was raised using the N terminal of ESRRA corresponding to a region with amino acids KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVN</p>

<p>C16ORF65 antibody was raised using the middle region of C16Orf65 corresponding to a region with amino acids TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI</p>

<p>The p63 antibody is a monoclonal antibody that specifically targets the p63 protein. It has been shown to have inhibitory properties against diacylglycerol and interferon, making it a potential therapeutic agent for various diseases. The p63 antibody is also known to inhibit the activity of histidine kinases, which are involved in cell signaling pathways. Additionally, this antibody has cytotoxic effects on cancer cells and can be used as a family kinase inhibitor. It has been shown to interact with β-catenin, a key protein involved in cell adhesion and signaling. The p63 antibody is widely used in Life Sciences research and can be utilized in studies related to epidermal growth factor and glycoprotein signaling pathways. Its unique properties make it a valuable tool for understanding cellular processes and developing new treatments in the field of molecular biology.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Kcnip3 antibody, catalog no. 70R-7941</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPIH antibody, catalog no. 70R-3821</p>

<p>Rabbit polyclonal PEBP1 antibody</p>

<p>Recombinant Pseudomonas aeruginosa Pseudolysin (lasB) protein</p>

<p>GPR75 antibody was raised using the middle region of GPR75 corresponding to a region with amino acids PSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MASTL antibody, catalog no. 70R-10147</p>

<p>MAD2L1BP antibody was raised in Rabbit using Human MAD2L1BP as the immunogen</p>

<p>Purified recombinant Human IFN alpha H2 protein</p>

<p>The LIMK1 antibody is a highly specific and potent monoclonal antibody that targets the LIM domain kinase 1 (LIMK1). This antibody is widely used in various immunoassays to study the role of LIMK1 in cellular processes. LIMK1 is an important regulator of actin cytoskeleton dynamics and has been shown to play a crucial role in cell migration, invasion, and metastasis. The LIMK1 antibody specifically recognizes and binds to the activated form of LIMK1, inhibiting its enzymatic activity and preventing its downstream signaling pathways. This antibody has been extensively validated for use in Western blotting, immunoprecipitation, immunofluorescence, and other molecular biology techniques. It is a valuable tool for researchers in the field of life sciences who are studying the molecular mechanisms underlying cellular processes regulated by LIMK1.</p>

<p>AMY2B antibody was raised in rabbit using the C terminal of AMY2B as the immunogen</p>