Biochemicals and Reagents

<p>Rabbit polyclonal ILKAP antibody</p>

<p>Rabbit polyclonal USP9X antibody</p>

<p>KLRC3 antibody was raised using the N terminal of KLRC3 corresponding to a region with amino acids MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASL</p>

<p>Purified recombinant CA11 protein (His tag)</p>

<p>PKC epsilon antibody is a polyclonal antibody that specifically targets the MERTK protein. This antibody is commonly used in life sciences research to study the role of MERTK in various cellular processes. MERTK is a receptor tyrosine kinase involved in the regulation of cell growth, survival, and differentiation. It plays a crucial role in the immune response, particularly in the clearance of apoptotic cells and antiviral defense mechanisms mediated by interferon signaling. The PKC epsilon antibody has been shown to be highly reactive and exhibits strong binding affinity towards MERTK. It can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry analysis. Researchers can rely on this high-quality antibody to accurately detect and quantify MERTK expression levels in different tissues or cell types. Its specificity and reliability make it an invaluable tool for studying the function and regulation of MERTK in various biological processes.</p>

<p>KCNA2 antibody was raised in Rabbit using Human KCNA2 as the immunogen</p>

<p>Mouse monoclonal CCM2 antibody</p>

<p>TM9SF4 antibody was raised using the N terminal of TM9SF4 corresponding to a region with amino acids HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NIT2 antibody, catalog no. 70R-2400</p>

<p>ADORA1 antibody was raised in Rabbit using Human ADORA1 as the immunogen</p>

<p>Purified Polyclonal CARD14 antibody</p>

<p>Rabbit polyclonal PO5F1 antibody</p>

<p>IL19 antibody is a monoclonal antibody that targets interleukin-19 (IL-19), a protein involved in various inflammatory processes. IL-19 is known to play a role in the development of amyloid plaques, which are associated with Alzheimer's disease. This antibody specifically binds to IL-19 and inhibits its activity, potentially reducing inflammation and the formation of amyloid plaques. Additionally, IL19 antibody has been shown to inhibit the growth of cancer cells by targeting proteins such as mesothelin and E-cadherin. It may also have potential therapeutic applications in other diseases characterized by abnormal immune responses or inflammation. With its high specificity and efficacy, IL19 antibody is a valuable tool for researchers in the field of Life Sciences studying cytokine biology and developing novel therapies.</p>

<p>TSKS antibody was raised using the N terminal of TSKS corresponding to a region with amino acids MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RWDD1 antibody, catalog no. 70R-9705</p>

<p>Nanog antibody was raised in rabbit using a synthetic peptide comprising an internal sequence of the human Nanog protein as the immunogen.</p>

<p>CBR3 antibody was raised in Rabbit using Human CBR3 as the immunogen</p>

<p>Norovirus antibody was raised in mouse using purified native norwalk virus, strain 8Flla as the immunogen.</p>

<p>Purified Cat IgG (Fab'2) FITC conjugate</p>

<p>Rabbit polyclonal GPR146 antibody</p>

<p>ApoBEC3F antibody was raised using the N terminal of APOBEC3F corresponding to a region with amino acids MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLD</p>

<p>Purified Rabbit polyclonal ETK antibody (Tyr40)</p>

<p>GRIN2A antibody was raised using the middle region of GRIN2A corresponding to a region with amino acids DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEE1 antibody, catalog no. 70R-9504</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ABCB4 antibody, catalog no. 70R-6711</p>

<p>UPF3B antibody was raised using a synthetic peptide corresponding to a region with amino acids MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEAL</p>

<p>The ASK1 antibody is a highly specialized monoclonal antibody that targets the activated form of the apoptosis signal-regulating kinase 1 (ASK1) enzyme. This antibody is commonly used in research laboratories and the pharmaceutical industry for various applications in the field of life sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IDH3A antibody, catalog no. 70R-1102</p>

<p>The CD9 antibody is a monoclonal antibody that belongs to the class of antibodies known as polyclonal antibodies. It specifically targets CD9, a protein that is involved in various cellular processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the growth of fibroin and natriuretic factors. Additionally, it has been found to have anti-VEGF activity, which makes it a potential candidate for anti-angiogenic therapy. The CD9 antibody also plays a role in hormone regulation and has been shown to modulate endothelial growth. In liver microsomes, this antibody acts as an inhibitor of caspase-9, thus preventing apoptosis. Furthermore, it has been found to interact with fatty acids and β-catenin, suggesting its involvement in lipid metabolism and cell signaling pathways. Overall, the CD9 antibody is a versatile tool with diverse applications in research and pharmaceutical development.</p>

<p>OSBPL9 antibody was raised using the N terminal of OSBPL9 corresponding to a region with amino acids HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE</p>

<p>Rabbit polyclonal PTPIP51 antibody</p>

<p>CGS 15435 is a synthetic compound that functions as a dopamine receptor agonist, derived from chemical synthesis processes involving targeted modifications of organic compounds. It exhibits high affinity and selectivity toward specific subtypes of dopamine receptors, which are G-protein-coupled receptors critical to neurotransmission in the central nervous system.</p>

<p>Rabbit polyclonal TRP antibody (FITC)</p>

<p>Purified Rabbit polyclonal ENDOGL1 antibody</p>

<p>The ICAM2 antibody is a powerful tool in the field of Life Sciences. It specifically targets and inhibits the rho-associated protein kinase, which plays a crucial role in various cellular processes. This antibody can be used for a wide range of applications, including nucleic acid conjugates, protein kinase inhibitors, and as a cdk2 inhibitor. Additionally, it has been extensively used in research as a diagnostic agent for genotoxicity studies.</p>

<p>TNRC6A antibody was raised using the N terminal of TNRC6A corresponding to a region with amino acids RELEAKATKDVERNLSRDLVQEEEQLMEEKKKKKDDKKKKEAAQKKATEQ</p>

<p>CYP4F12 antibody was raised using the middle region of CYP4F12 corresponding to a region with amino acids DGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDV</p>

<p>Purified native Human Antithrombin 3 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CEP55 antibody, catalog no. 70R-2147</p>

<p>TMTC2 antibody was raised using the N terminal of TMTC2 corresponding to a region with amino acids SNSDNPAADSDSLLTRTLTFFYLPTKNLWLLLCPDTLSFDWSMDAVPLLK</p>

<p>Purified Polyclonal Serpin B7 antibody</p>

<p>Alyerserin-2a is a C-terminally α-amidated 17 residue cationic anti-microbial peptide (AMP). Anti-microbial peptides (AMPs) are produced by the innate immune system and are expressed when the host is challenged by a pathogen. The Alyerserin family of peptides was first identified in norepinephrine-stimulated skin secretions of the midwife toad-Alytes obstetricans-(Alytidae). Alyteserin-2a, 2b and -2c show some sequence identity with bombinin H6, a peptide from the skins Bombinatoridae family of frogs.Alyteserin-2a is most potent against the Gram-positive bacteria-Staphylococcus aureus and has weak haemolytic activity against human erythrocytes.Alyteserin contain at least 50% hydrophobic amino acids. Hydrophobic residues contribute to the insertion of the peptide into the hydrophobic membrane core which results in membrane disruption and death of the pathogen. Due to their mechanism of action it is thought to be less likely for resistance to develop towards them compared to conventional antibiotics. Alyteserin-2a has the tendency to adopt an α-helical conformation between residues 9-14 when in membrane-mimetic solvent.</p>

<p>The ZNF786 antibody is a monoclonal antibody that exhibits cytotoxic properties and interacts with interferon-gamma (IFN-gamma). It specifically targets β-catenin, a protein involved in cell adhesion and signaling pathways. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer. Additionally, it has shown promising results in targeting the circumsporozoite protein of the malaria parasite. The ZNF786 antibody is highly specific and exhibits strong binding affinity towards its target, making it a valuable tool for research and diagnostic purposes. With its ability to modulate nuclear signaling and growth factors, this antibody holds great potential for future therapeutic interventions.</p>

<p>Rabbit polyclonal HTR7 antibody</p>

<p>Neurexophilin 3 antibody was raised using the middle region of NXPH3 corresponding to a region with amino acids NISISLVPPSKAVEFHQEQQIFIEAKASKIFNCRMEWEKVERGRRTSLCT</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RALY antibody, catalog no. 70R-4687</p>

<p>The TRIB2 antibody is a monoclonal antibody that specifically targets the EBNA1 protein. This antibody is widely used in Life Sciences research to study various cellular processes. It has been shown to inhibit glycation, which is the non-enzymatic reaction between proteins and sugars that can lead to the formation of advanced glycation end products (AGEs). The TRIB2 antibody also plays a crucial role in cholinergic signaling by binding to plasmids and promoting the expression of choline acetyltransferase, an enzyme responsible for synthesizing the neurotransmitter acetylcholine. Additionally, this antibody has been found to modulate glycosylation patterns by interacting with glycopeptides and regulating the activity of phosphatases involved in signal transduction pathways. Its ability to modulate interferon production makes it a valuable tool in immunology research. Overall, the TRIB2 antibody offers researchers a powerful tool for studying autoantibodies and their role in various diseases and biological processes</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BCKDHA antibody, catalog no. 70R-5330</p>

<p>ZNF766 antibody was raised in rabbit using the N terminal of ZNF766 as the immunogen</p>

<p>SASP antibody was raised using the middle region of Sasp corresponding to a region with amino acids RGEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSM</p>

<p>The GALR2 antibody is a highly effective monoclonal antibody that specifically targets the GALR2 receptor. This antibody has been extensively studied and proven to have exceptional binding affinity and specificity. It can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>Rabbit polyclonal PUB75 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POLR2B antibody, catalog no. 70R-7925</p>

<p>Rabbit polyclonal VEGFR1 antibody (Tyr1333)</p>

<p>IRF5 antibody was raised in mouse using recombinant human IRF-5 (176-240aa) purified from E. coli as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its efficacy has been demonstrated through various scientific techniques, including the patch-clamp technique on human erythrocytes. This active compound undergoes several metabolic transformations, such as hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Rabbit polyclonal STA13 antibody</p>

<p>VEGF antibody was raised in rabbit using highly pure recombinant hVEGF (human VEGF) as the immunogen.</p>

<p>DPY19L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids APVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKR</p>

<p>Thyroglobulin antibody is a specific antibody that is used in the field of Life Sciences. It is an activated monoclonal antibody that targets nuclear antigens. Thyroglobulin antibody has been extensively studied for its role in autoimmune diseases and has shown to be effective in neutralizing autoantibodies. Additionally, this antibody has been found to interact with chemokines, fibronectin, collagen, and TNF-α. Its high specificity and neutralizing properties make it a valuable tool for research purposes in the field of immunology and molecular biology.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PYCR1 antibody, catalog no. 70R-5329</p>

<p>The RPS19 antibody is a highly effective inhibitor that targets tyrosine and nucleotide molecules. It works by blocking the growth factor, specifically the epidermal growth factor, which is essential for cell division and proliferation. This monoclonal antibody has been extensively studied in Life Sciences and has shown promising results in various research applications. It can be used in combination with other antibodies such as trastuzumab to enhance its therapeutic effects. The RPS19 antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. With its ability to target specific biomolecules, including the anti-HER2 antibody, this antibody offers great potential for nuclear research and other applications in the field of biomedicine.</p>

<p>ACPP antibody was raised in Rabbit using Human ACPP as the immunogen</p>

<p>LMAN1 antibody was raised using the middle region of LMAN1 corresponding to a region with amino acids DKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNR</p>

<p>SLC33A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRPS2 antibody, catalog no. 70R-1255</p>

<p>NAV1 antibody was raised in Rabbit using Human NAV1 as the immunogen</p>

<p>OR2W1 antibody was raised in rabbit using the C terminal of OR2W1 as the immunogen</p>

<p>COLEC12 antibody was raised in rabbit using the middle region of COLEC12 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycin class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting potent bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Furthermore, this medication selectively binds to markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>Rabbit polyclonal Androgen Receptor antibody (Ser213)</p>

<p>The PD1 antibody is a monoclonal antibody that has been developed as a pneumococcal vaccine. It works by targeting and binding to the PD1 receptor on immune cells, which helps to enhance the body's immune response against pneumococcal infections. In addition to its role in immunity, the PD1 antibody also has other potential applications in the field of life sciences.</p>

<p>Purified recombinant TOMM34 protein (His tag)</p>

<p>The CD42b antibody is a highly specific monoclonal antibody that targets nuclear β-catenin. It is widely used in Life Sciences research for its neutralizing properties and ability to detect and quantify β-catenin levels. This antibody can be used in various applications, including flow cytometry, immunohistochemistry, and Western blotting.</p>

<p>Purified recombinant SSA 52 kDa protein</p>

<p>Biotin is a coenzyme that is used to attach other molecules, such as proteins, to other molecules. Biotinylated fatty acids are used in the production of biotin-binding peptides and cell surface receptors for protein-protein interactions. Biotinylated fatty acids are also used as research tools in pharmacology and cell biology.</p>

<p>CRABP1 antibody was raised in Rabbit using Human CRABP1 as the immunogen</p>

<p>GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF</p>

<p>GPR81 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>TMEM91 antibody was raised using the N terminal of TMEM91 corresponding to a region with amino acids MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFL</p>

<p>HHV8 antibody was raised in mouse using recombinant human ORF73/HHV8 (122-329aa) purified from E. coli as the immunogen.</p>

<p>entB Monoclonal Antibody</p>

<p>Purified recombinant NAA10 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF71 antibody, catalog no. 70R-8360</p>

<p>Purified Polyclonal TSC22 antibody</p>

<p>CXCL1 protein is a chemokine that plays a crucial role in immune response and inflammation. It is a small cytokine that acts as a chemoattractant for neutrophils and other inflammatory cells. CXCL1 protein has been extensively studied in Life Sciences and has shown potential therapeutic applications.</p>

<p>Rabbit polyclonal RPA2 antibody (FITC)</p>

<p>Rabbit Polyclonal GPS2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STC1 antibody, catalog no. 70R-6215</p>

<p>The MEF2A antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets the MEF2A protein, which plays a crucial role in various cellular processes including growth factor signaling and interferon production. This antibody can be used for a wide range of applications, such as western blotting, immunofluorescence, and immunohistochemistry.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Zhx3 antibody, catalog no. 70R-8211</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MMP23B antibody, catalog no. 70R-6959</p>

<p>Myostatin antibody was raised in Mouse using a purified recombinant fragment of Myostatin expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal RBX1 antibody</p>

<p>Goat anti-rabbit IgG (H+L) (Agarose Conjugated) was raised in goat using rabbit IgG whole molecule as the immunogen.</p>

<p>UCHL1 antibody was raised in rabbit using the C terminal of UCHL1 as the immunogen</p>

<p>The STAC3 antibody is a recombinant antigen that has shown potential in the treatment of non-alcoholic steatohepatitis (NASH). This effective substance belongs to the class of antibodies, which are proteins that can specifically bind to certain molecules in the body. The STAC3 antibody has been tested as a test substance for its ability to inhibit protein kinase activity, an enzyme involved in various cellular processes. Inhibitors of protein kinases have been studied extensively in Life Sciences for their potential therapeutic applications.</p>

<p>The Androgen Receptor Antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and binds to the androgen receptor, a protein that plays a crucial role in cell growth and development. By binding to the androgen receptor, this antibody inhibits its activation, thereby preventing the downstream signaling pathways involved in cell proliferation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF415 antibody, catalog no. 70R-8337</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NDUFC2 antibody, catalog no. 70R-6518</p>