Biochemicals and Reagents

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLT3LG antibody, catalog no. 70R-7181</p>

<p>The Biotin antibody is a highly specialized product used in the field of Life Sciences. It is a monoclonal antibody that has been specifically designed for biotinylation purposes. This antibody is commonly used in various research applications such as immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>Sheep RBC antibody (Texas Red) was raised in rabbit using sheep erythrocytes as the immunogen.</p>

<p>Purified recombinant PHB protein (His tag)</p>

<p>Rabbit polyclonal BTF3 antibody (biotin)</p>

<p>NBL1 antibody was raised using the middle region of NBL1 corresponding to a region with amino acids GLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAE</p>

<p>Rabbit polyclonal SUGT1 antibody</p>

<p>OR6C75 antibody was raised using the middle region of OR6C75 corresponding to a region with amino acids SCIFMYIKTSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFKS</p>

<p>The CHAT antibody is a monoclonal antibody that targets the oncogene homolog, β-catenin. It is activated by adeno-associated virus and has been widely used in Life Sciences research. This antibody specifically binds to the target molecule, inhibiting its activity and preventing downstream effects. The CHAT antibody has also shown promising results in studies involving steroid-induced apoptosis, caspase-9 activation, and cholinergic signaling pathways. With its high specificity and effectiveness, this antibody is a valuable tool for researchers studying various biological processes and diseases such as cryptosporidium infection.</p>

<p>The PFKP antibody is a highly specialized monoclonal antibody that targets the protein kinase enzyme. It has been extensively studied for its potential therapeutic applications in various fields, including interferon research, non-alcoholic steatohepatitis treatment, and industrial protein kinase inhibitors.</p>

<p>Rabbit polyclonal RUNX1T1 antibody</p>

<p>alpha Actinin 1 antibody was raised using the N terminal of ACTN1 corresponding to a region with amino acids  DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>The FXN antibody is a highly effective medicament that exhibits cytotoxic properties. It is administered through the use of adeno-associated virus vectors, which deliver the monoclonal antibody directly to targeted cells. The FXN antibody specifically targets tumor necrosis factor-alpha (TNF-α), a protein known to play a crucial role in inflammation and cell death processes. By binding to TNF-α, this monoclonal antibody effectively inhibits its activity and prevents the progression of inflammatory diseases.</p>

<p>Mouse monoclonal MRI1 antibody</p>

<p>PARVB antibody was raised using the C terminal of PARVB corresponding to a region with amino acids HNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE</p>

<p>ZNF264 antibody was raised in rabbit using the C terminal of ZNF264 as the immunogen</p>

<p>Myosin antibody was raised in mouse using chicken muscle cells as the immunogen.</p>

<p>Carboxylesterase 7 antibody was raised using the N terminal of CES7 corresponding to a region with amino acids SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP</p>

<p>The MOR antibody is a monoclonal antibody that specifically targets the mu-opioid receptor (MOR). This receptor plays a crucial role in mediating the effects of opioids and is involved in pain management and addiction. The MOR antibody has high affinity and specificity for the MOR, making it an excellent tool for studying opioid signaling pathways and developing new therapeutic strategies.</p>

<p>Rabbit polyclonal UBE2E3 antibody</p>

<p>The TPT1 protein is a versatile and essential component in the field of Life Sciences. It plays a crucial role in various biological processes, such as hemolysis, growth factor signaling, and carbonic anhydrase activity. This protein has gained significant attention due to its unique characteristics.</p>

<p>Zfp90 antibody was raised in rabbit using the N terminal of Zfp90 as the immunogen</p>

<p>Rabbit polyclonal PKC theta antibody</p>

<p>Rabbit polyclonal ZNF259 antibody</p>

<p>Mouse monoclonal TAL1 antibody</p>

<p>SLC5A11 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The PEPD antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of life sciences. This antibody specifically targets and detects antiphospholipid antibodies, which are autoantibodies that can cause various health complications. The PEPD antibody is designed to recognize and bind to these specific antibodies, allowing for their detection and analysis.</p>

<p>Purified Rabbit polyclonal MYLIP antibody</p>

<p>Galectin 3 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets galectin 3, a protein that plays a role in various biological processes. This antibody can be used to detect and quantify galectin 3 levels in samples, making it a valuable tool for studying its function and potential therapeutic applications.</p>

<p>The MMP7 antibody is a highly specific monoclonal antibody that targets the matrix metalloproteinase 7 (MMP7) enzyme. MMP7 plays a crucial role in various biological processes, including tissue remodeling, wound healing, and cell proliferation. This antibody is widely used in Life Sciences research to study the function and regulation of MMP7.</p>

<p>Purified Polyclonal GPR179 antibody</p>

<p>ZFP42 antibody was raised in rabbit using the middle region of ZFP42 as the immunogen</p>

<p>Mouse monoclonal PSMB9 antibody</p>

<p>Rabbit polyclonal AurB antibody</p>

<p>UGT1A4 antibody was raised using the N terminal of UGT1A4 corresponding to a region with amino acids VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK</p>

<p>Purified recombinant HAX1 protein (His tag)</p>

<p>Purified recombinant TNFRSF1A protein (His tag)</p>

<p>Purified recombinant IL17B protein (His tag)</p>

<p>SCO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL</p>

<p>The HES6 antibody is a highly specialized antibody used in the field of Life Sciences. It is a polyclonal antibody that specifically targets and neutralizes HES6, a protein involved in various cellular processes. This antibody has been shown to be effective in blocking the activity of HES6, which plays a crucial role in regulating cell growth and differentiation.</p>

<p>Rabbit polyclonal THRA antibody</p>

<p>Mouse monoclonal CD38 antibody (biotin)</p>

<p>LRCH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGHRYDGGLDSGFHSVDSGSKRWSGNESTDEFSELSFRISELAREPRGPR</p>

<p>Rabbit polyclonal IL8R beta antibody (Ser347)</p>

<p>2-​[4-​(Diethylamino)​phenyl]​-​3,​6-​dimethyl-benzothiazolium chloride is a molecule that has regulatory activity. This innovative drug can be used to highlight and respond to the virus in retroviruses. Its use has been shown to be effective in treating hepatitis caused by viral replication. 2-[[4-(Diethylamino)phenyl]]-3,6-dimethylbenzothiazolium chloride is also known as TMC207, an organometallic compound that is statistically more potent than other inhibitors of viral replication.</p>

<p>Mouse monoclonal XRCC1 antibody</p>

<p>UBE2C antibody was raised using the N terminal of UBE2C corresponding to a region with amino acids ELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPS</p>

<p>Mouse monoclonal GLP1 antibody (Biotin)</p>

<p>Rabbit polyclonal VEZT antibody</p>

<p>The ACSS2 antibody is a highly specialized product in the field of Life Sciences. It acts as an inhibitory factor against specific targets, such as amyloid plaque formation. This monoclonal antibody has been developed to specifically recognize and bind to transferrin, an acidic glycoprotein involved in iron transport. By targeting transferrin, the ACSS2 antibody exerts cytotoxic effects on cells that overexpress this protein.</p>

<p>Kinectin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNDLREKNWEAMEALA</p>

<p>TWIST antibody was raised in mouse using recombinant Human Twist Homolog 1 (Acrocephalosyndactyly 3; Saethre-Chotzen Syndrome) (Drosophila) (Twist1)</p>

<p>GLRX antibody was raised using a synthetic peptide corresponding to a region with amino acids IKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLV</p>

<p>GPRC5B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Purified Rabbit polyclonal ETNK1 antibody</p>

<p>The ATF2 antibody is a highly specialized antibody that is used in Life Sciences research. It is an inhibitor of the epidermal growth factor and acts as a cytotoxic agent against specific cells. This monoclonal antibody specifically targets ATF2, a transcription factor involved in cell growth and development. The ATF2 antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It is available as both a recombinant antigen and as polyclonal antibodies. The neutralizing properties of this antibody make it an essential tool for studying the role of ATF2 in cellular processes. With its high specificity and affinity to the target protein, the ATF2 antibody provides accurate and reliable results in research experiments.</p>

<p>KIFC3 antibody was raised using the C terminal of KIFC3 corresponding to a region with amino acids EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV</p>

<p>TMEM126B antibody was raised using the N terminal of TMEM126B corresponding to a region with amino acids AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT</p>

<p>Rabbit polyclonal OR5B12 antibody</p>

<p>Mouse monoclonal ATP5B antibody</p>

<p>Rabbit polyclonal CaMK1A antibody (Thr177)</p>

<p>SLC5A4 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal SERINC3 antibody</p>

<p>ULBP1 antibody was raised using the N terminal of ULBP1 corresponding to a region with amino acids MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWC</p>

<p>The Histone H3 antibody is a monoclonal antibody that specifically targets histone H3, a protein involved in the packaging of DNA into chromatin. This antibody is commonly used in research studies to investigate histone modifications and their impact on gene expression. It is particularly useful for techniques such as chromatin immunoprecipitation assay (ChIP) which allows researchers to study the interactions between proteins and DNA. The Histone H3 antibody has been extensively validated and is known for its high specificity and sensitivity. It has been successfully used in various applications including Western blotting, immunofluorescence, and immunohistochemistry. Researchers can rely on this antibody to accurately detect histone H3 acetylation levels and gain insights into epigenetic regulation of gene expression.</p>

<p>Purified recombinant STRADA protein (His tag)</p>

<p>KLC1 antibody was raised in Rabbit using Human KLC1 as the immunogen</p>

<p>MAP3K11 antibody was raised using the middle region of MAP3K11 corresponding to a region with amino acids PVGQRSAKSPRREEEPRGGTVSPPPGTSRSAPGTPGTPRSPPLGLISRPR</p>

<p>The DPPA2 antibody is a monoclonal antibody that targets and neutralizes the growth factor DPPA2. It has been shown to inhibit caspase-9 activity, which plays a crucial role in apoptosis. This antibody is formulated with excipients such as histidine and colloidal globulin to enhance stability and efficacy. It can be used in various applications in Life Sciences, including research on mesenchymal stem cells and alpha-fetoprotein. The DPPA2 antibody is a highly specific and potent tool for studying the function of DPPA2 and its role in cellular processes.</p>

<p>Insulin antibody was raised in mouse using human insulin as the immunogen.</p>

<p>ZNF644 antibody was raised in rabbit using the middle region of ZNF644 as the immunogen</p>

<p>The MPL antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets the myeloproliferative leukemia (MPL) receptor, which is a tyrosine kinase receptor involved in the regulation of hematopoiesis. This antibody has been extensively studied and has shown neutralizing activity against MPL ligands such as thrombopoietin, resulting in the inhibition of downstream signaling pathways.</p>

<p>ANP32A antibody was raised using a synthetic peptide corresponding to a region with amino acids FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE</p>

<p>The BSG antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is designed to bind to the glycan moiety of TNF-α, preventing its interaction with cell surface receptors. This antibody can be used in various research applications, such as immunohistochemistry and flow cytometry, to detect and quantify TNF-α levels. The BSG antibody has been extensively validated and shown to have high specificity and affinity for TNF-α. Its neutralizing properties make it a valuable tool for studying the role of TNF-α in various physiological and pathological processes. Additionally, this antibody has been used in therapeutic settings, such as the treatment of inflammatory diseases like rheumatoid arthritis, where excessive TNF-α production plays a key role in disease progression.</p>

<p>Purified recombinant TMED10 protein (His tag)</p>

<p>Purified recombinant Human OLA1 protein (His tag)</p>

<p>PHACTR3 antibody was raised using the C terminal of PHACTR3 corresponding to a region with amino acids IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR</p>

<p>The BRAF antibody is a highly specialized and reactive antibody that targets the activated form of the BRAF protein. This protein is involved in cell growth and plays a crucial role in various biological processes. The BRAF antibody is cytotoxic, meaning it has the ability to kill cells that express high levels of the activated BRAF protein.</p>

<p>Rabbit polyclonal DNAPK antibody</p>

<p>Purified Rabbit polyclonal BMP8B antibody</p>

<p>LEO1 antibody was raised in Rabbit using Human LEO1 as the immunogen</p>

<p>Rat monoclonal CCR7 antibody (biotin)</p>

<p>Rabbit polyclonal RNF138 antibody</p>

<p>Purified recombinant BMP6 protein (His tag)</p>

<p>Purified recombinant DEFB116 protein (His tag)</p>

<p>Rat monoclonal V alpha 2 TCR antibody (PE)</p>

<p>Aquaporin 7 antibody was raised using the C terminal of AQP7 corresponding to a region with amino acids DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA</p>

<p>The TIE1 antibody is a highly specific antibody that targets the TIE1 protein, which is an important receptor involved in various biological processes. This monoclonal antibody is widely used in life sciences research to study the role of TIE1 in insulin signaling, adiponectin signaling, and growth factor regulation.</p>

<p>CYP3A43 antibody was raised using the C terminal of CYP3A43 corresponding to a region with amino acids IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR</p>

<p>Mouse monoclonal CP15 antibody</p>

<p>Rabbit polyclonal OR10C1 antibody</p>

<p>BAT5 antibody was raised using the middle region of BAT5 corresponding to a region with amino acids RAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPL</p>

<p>GPT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLG</p>

<p>The Beta-2-microglobulin monoclonal antibody is a highly specialized antibody that targets and interacts with beta-2-microglobulin, a protein found on the surface of various cells. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in different applications.</p>

<p>IMPAD1 antibody was raised using the N terminal of IMPAD1 corresponding to a region with amino acids VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL</p>

<p>Mouse monoclonal MPP5 antibody</p>

<p>The MDM2 antibody is a neutralizing monoclonal antibody that targets the MDM2 protein. It has been shown to inhibit the activity of interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α), two pro-inflammatory cytokines involved in immune responses. This antibody is reactive against adipose tissue and has been used in studies involving conditions such as obesity and metabolic disorders. Additionally, the MDM2 antibody has shown potential therapeutic effects against Brucella abortus, a bacterial pathogen that causes brucellosis. The colloidal gold-labeled MDM2 antibody can be used for immunohistochemistry or immunocytochemistry applications. This antibody also demonstrates inhibitory activity against certain family kinases and amyloid proteins. Overall, the MDM2 antibody offers a versatile tool for researchers studying various biological processes and diseases related to MDM2 and its associated pathways.</p>

<p>delta Catenin antibody was raised in mouse using synthetic peptide J6 (corresponding to aa 292-309) coupled to KLH as the immunogen.</p>

<p>Human IgG1 antibody was raised in mouse using IgG1 Fc region as the immunogen.</p>