Biochemicals and Reagents

<p>CD104 antibody was raised in rat using tumor-associated antigen TSP-180 immunoaffinity purified from a transplantable BALB/c mouse lung cell carcinoma as the immunogen.</p>

<p>The PFKL antibody is an activated antibody that specifically targets the racemase enzyme. It is commonly used in Life Sciences research and assays to study the role of this enzyme in various biological processes. The PFKL antibody is available as both a polyclonal antibody and a monoclonal antibody, providing researchers with options for their specific experimental needs. This antibody can be used for a range of applications, including immunohistochemistry, Western blotting, and ELISA. Its high specificity and sensitivity make it a valuable tool for detecting and quantifying the presence of racemase in samples such as human serum or extracellular fluids. Additionally, the PFKL antibody can be used in combination with other cytotoxic inhibitors or antibodies to study complex signaling pathways or protein interactions. Whether you are conducting basic research or developing new diagnostic tools, the PFKL antibody is an essential component for your experiments.</p>

<p>The CHD1L antibody is a polyclonal antibody that targets the growth factor CHD1L. It can be used in various applications, including insulin antibody assays and as a research tool for studying the role of CHD1L in different biological processes. This antibody has also been used in combination with other antibodies, such as trastuzumab, to detect specific proteins or biomarkers in samples. Additionally, it has shown reactivity with thymidylate synthase and anti-HER2 antibodies in human serum, making it a valuable tool for diagnostic purposes. The CHD1L antibody can be used in both monoclonal and polyclonal forms, offering flexibility for different experimental setups. Its specificity towards glial fibrillary acidic protein (GFAP) makes it particularly useful for studying autoimmune diseases or neurological disorders involving GFAP autoantibodies. Researchers can rely on this antibody to provide accurate and reliable results in their investigations.</p>

<p>KIR2DL4 antibody was raised using the middle region of KIR2DL4 corresponding to a region with amino acids VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR</p>

<p>IL4 antibody was raised in mouse using recombinant human IL-4 as the immunogen.</p>

<p>Mouse monoclonal PYCRL antibody</p>

<p>Rabbit polyclonal MIF antibody (biotin)</p>

<p>MTRF1L antibody was raised using the N terminal of MTRF1L corresponding to a region with amino acids MRSRVLWGAARWLWPRRAVGPARRPLSSGSPPLEELFTRGGPLRTFLERQ</p>

<p>Rabbit polyclonal GPR173 antibody</p>

<p>Mouse monoclonal CD3 antibody (FITC)</p>

<p>PIGT antibody was raised using the N terminal of PIGT corresponding to a region with amino acids PLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHL</p>

<p>TNF beta antibody was raised in rabbit using highly pure recombinant human TNF-beta as the immunogen.</p>

<p>LRRC23 antibody was raised using the N terminal of LRRC23 corresponding to a region with amino acids LEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKADGN</p>

<p>Rabbit polyclonal PCYT2 antibody</p>

<p>Rabbit polyclonal DYR1B antibody</p>

<p>LRRC8E antibody was raised using the middle region of LRRC8E corresponding to a region with amino acids LRELKQLKVLSLRSNAGKVPASVTDVAGHLQRLSLHNDGARLVALNSLKK</p>

<p>Rabbit polyclonal MECP2 antibody (Ser80)</p>

<p>Rabbit polyclonal Daxx antibody (Ser668)</p>

<p>The MCPH1 antibody is a highly specialized antibody that targets the protein MCPH1. This protein plays a crucial role in various biological processes, including collagen synthesis, phosphorylation site regulation, and antinociceptive activity. The MCPH1 antibody is widely used in Life Sciences research to study the function and regulation of this protein.</p>

<p>Mouse monoclonal PDE6G antibody</p>

<p>NFKB P52 antibody was raised in rabbit using human NFKB2 p52/p100 peptide corresponding to residues 1-19 of the human protein conjugated to KLH as the immunogen.</p>

<p>PTGS1 antibody was raised using the middle region of PTGS1 corresponding to a region with amino acids GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE</p>

<p>Mouse monoclonal RNH1 antibody</p>

<p>ZNF226 antibody was raised in rabbit using the middle region of ZNF226 as the immunogen</p>

<p>S100PBP antibody was raised using the middle region of S100PBP corresponding to a region with amino acids ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQ</p>

<p>Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.</p>

<p>The GLP1R antibody is a peptide nucleic acid that specifically binds to GLP-1 receptor (GLP1R) binding proteins. It is a polyclonal antibody commonly used in Life Sciences research. This antibody has been shown to block the activation of factor-α, a key mediator of inflammation. Additionally, it has been demonstrated to enhance the natriuretic response in animal models. The GLP1R antibody can be used in various experimental techniques such as electrode assays, botulinum toxin studies, and β-catenin signaling analysis. This high-quality antibody is produced using state-of-the-art technology and undergoes rigorous quality control testing to ensure optimal performance. Order now and unlock new insights into GLP-1 receptor biology.</p>

<p>MAGEA4 antibody was raised in Rabbit using Human MAGEA4 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPATA12 antibody, catalog no. 70R-9013</p>

<p>The SERCA1 antibody is a highly specialized antibody that plays a crucial role in nitrogen metabolism. It belongs to the class of imidazolidine derivatives and has neutralizing properties. This antibody is used in various research applications, including the development of monoclonal antibodies for targeted therapies. It has been shown to inhibit the activity of TNF-α (tumor necrosis factor-alpha), a growth factor involved in inflammation and immune response. Additionally, the SERCA1 antibody has been found to interact with other proteins such as usnic acid and the rubisco enzyme, further highlighting its versatility and potential applications. Polyclonal Antibodies specific to SERCA1 are also available, providing researchers with a comprehensive toolset for their studies. Furthermore, this antibody has shown interactions with cyanobacterial proteins, interleukin-6, hepcidin, and parathyroid hormone-related peptide, suggesting its involvement in various biological processes and signaling pathways. With its wide range of applications and potential therapeutic</p>

<p>SF1 antibody was raised using the C terminal of SF1 corresponding to a region with amino acids MASSTPLPWQQNTTTTTTSAGTGSIPPWQQQQAAAAASPGAPQMQGNPTM</p>

<p>TRPC6 antibody was raised using the middle region of TRPC6 corresponding to a region with amino acids KKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSE</p>

<p>1-101 amino acids: MGSSHHHHHH SSGLVPRGSH MACPLEKALD VMVSTFHKYS GKEGDKFKLN KSELKELLTR ELPSFLGKRT DEAAFQKLMS NLDSNRDNEV DFQEYCVFLS CIAMMCNEFF EGFPDKQPRK K</p>

<p>The S6K1 antibody is a powerful tool for researchers in the field of life sciences. It is an antibody that specifically targets and inhibits the activity of S6K1, a protein kinase that plays a crucial role in various cellular processes. This polyclonal antibody has been extensively validated and proven to be highly specific and effective in blocking the activation of S6K1.</p>

<p>The BSA antibody is a highly specialized antibody that is used in various assays and research applications in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering different advantages depending on the specific needs of the experiment.</p>

<p>The VEGFD antibody is a highly specialized antibody that targets Vascular Endothelial Growth Factor D (VEGFD). This antibody has been extensively studied and has shown great potential in various fields, particularly in the Life Sciences.</p>

<p>Recombinant E.coli idnk protein</p>

<p>Purified recombinant CNRIP1 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VSIG8 antibody, catalog no. 70R-6416</p>

<p>MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREI</p>

<p>MIP1 beta antibody was raised in rabbit using highly pure recombinant human MIP-1-beta as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal HRPAP20 antibody</p>

<p>Purified Polyclonal IKK gamma antibody</p>

<p>Sheep polyclonal Clostebol antibody</p>

<p>Rabbit polyclonal IKK gamma antibody (Ser376)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FTCD antibody, catalog no. 70R-1140</p>

<p>Purified Polyclonal NEFL antibody</p>

<p>The CD18 antibody is a highly specialized Polyclonal Antibody used in Life Sciences research. It is known for its antiangiogenic properties and its ability to neutralize endothelial growth factors, chemokines, and other growth factors involved in cell proliferation. This antibody has been extensively studied and proven effective in various research applications.</p>

<p>Purified recombinant Human AHCY protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPIE antibody, catalog no. 70R-1435</p>

<p>Purified native Pneumonia virus of Mice protein</p>

<p>Rabbit polyclonal GLI3 antibody</p>

<p>CMV pp65 protein:<br>CMV pp65 (120-129) is an epitope of the main component of the enveloped subviral particle pp65 (phosphoprotein ppUL83) of Cytomegalovirus, a member of herpes virus group. CMV pp65 antigens are used as target for the diagnosis of concomitant CMV end-organ disease.<br>Applications of CMV pp65 (120-129):<br>CMV pp65 (120-129) HLA-A*02:01-restricted is an immunodominant target of CD4+ and CD8+ responses to CMV. CMV pp65 (120-129) is used to stimulate in vitro pp65-specific CD4+ and CD8+ T cells in PBMCs and to analyze by ELISPOT peptide epitope specificity and cytokine production like IFN-γ, IL-2 and TFN-α.</p>

<p>BACE1 antibody was raised using the N terminal of BACE1 corresponding to a region with amino acids GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY</p>

<p>The BARD1 antibody is a highly specific monoclonal antibody that targets the BARD1 protein isoforms. It has been extensively tested and validated in various bioassays and is widely used in life sciences research. This antibody specifically recognizes BARD1, a protein involved in cell growth regulation and DNA repair processes. It binds to BARD1 with high affinity, making it an excellent tool for studying the function and localization of this important protein. The BARD1 antibody can be used in applications such as Western blotting, immunohistochemistry, and immunofluorescence to investigate the role of BARD1 in different cellular contexts. Its high specificity ensures accurate and reliable results, making it an indispensable tool for researchers studying cell signaling pathways and cancer biology.</p>

<p>Purified recombinant GPI protein (His tag)</p>

<p>Rat monoclonal PD1 antibody (PE)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADSSL1 antibody, catalog no. 70R-4108</p>

<p>Rabbit polyclonal KOR1 antibody</p>

<p>Mouse monoclonal MGLL antibody</p>

<p>Mouse monoclonal SLC2A6 antibody</p>

<p>RTN3 antibody was raised in Mouse using a purified recombinant fragment of RTN3 expressed in E. coli as the immunogen.</p>

<p>Goat anti-rat IgG (H + L) (Fab'2) (Rhodamine) was raised in goat using rat IgG whole molecule as the immunogen.</p>

<p>Purified recombinant DTYMK protein</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Purified Polyclonal Caspase 10 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SRPK1 antibody, catalog no. 70R-10336</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Tmem147 antibody, catalog no. 70R-8854</p>

<p>Rabbit polyclonal Catenin beta antibody</p>

<p>The USP37 antibody is a highly specialized monoclonal antibody that has neutralizing properties. It specifically targets E-cadherin, a protein involved in cell adhesion and signaling. This antibody has been extensively studied in the field of life sciences, particularly in the context of chemokine and interleukin-6 signaling pathways. It has also been used in various research techniques, such as immunofluorescence staining with phalloidin to visualize actin cytoskeleton, dopamine release assays, and electrophoresis studies involving fibrinogen. The USP37 antibody has shown promising results in granulosa cell research and has been utilized in agglutination assays for detecting erythropoietin levels. Its specificity and reliability make it a valuable tool for researchers working with antibodies.</p>

<p>Rabbit polyclonal p50 CDC37 antibody</p>

<p>TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV</p>

<p>CLAD 3 Conjugate for use in immunoassays</p>

<p>Abcb10 antibody was raised in rabbit using the N terminal of Abcb10 as the immunogen</p>

<p>DHRS2 antibody was raised in rabbit using the N terminal of DHRS2 as the immunogen</p>

<p>Purified Polyclonal RhoD antibody</p>

<p>Mouse monoclonal ZIM2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DSG2 antibody, catalog no. 70R-6105</p>

<p>The ACADL antibody is a neurotrophic factor monoclonal antibody that has shown promising results in various studies. This antibody acts as a growth factor and has the ability to promote cell survival and differentiation. It can be used in research settings to study the effects of neurotrophic factors on neuronal development and function.</p>

<p>Rabbit polyclonal RPL17 antibody (FITC)</p>

<p>SLC6A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGLAFLAYPEAVT</p>

<p>KPTN antibody was raised in Rabbit using Human KPTN as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARPC3 antibody, catalog no. 70R-3074</p>

<p>Pin1 antibody was raised in mouse using recombinant human Pin1 (1-163aa) purified from E. coli as the immunogen.</p>

<p>Rabbit polyclonal USP38 antibody</p>

<p>Rabbit polyclonal AGP2 antibody (HRP)</p>

<p>DNAJA2 antibody was raised in Rabbit using Human DNAJA2 as the immunogen</p>

<p>Rabbit polyclonal MARK2 antibody</p>

<p>The SNAI1 antibody is a monoclonal antibody that specifically targets the SNAI1 protein. This protein plays a crucial role in various cellular processes, including cell growth and differentiation. The SNAI1 antibody has been extensively tested and validated for its specificity and sensitivity in detecting the presence of SNAI1 in different samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AKR1B1 antibody, catalog no. 70R-1071</p>

<p>Rabbit anti-rat IgG (H+L) (Rhodamine) was raised in rabbit using rat IgG whole molecule as the immunogen.</p>

<p>The BSG antibody is a monoclonal antibody that is used in the field of Life Sciences. It specifically targets and binds to BSG (basigin) protein, which is expressed on the surface of cardiomyocytes. This antibody has been shown to be effective in inhibiting the activation of BSG, making it a valuable tool for studying the role of BSG in various cellular processes. Additionally, the BSG antibody can be used as a diagnostic tool in human serum samples to detect the presence of activated BSG. With its cytotoxic properties, this monoclonal antibody has also shown promise as a potential treatment for certain types of cancer. Its ability to target nuclear proteins and inhibit protein kinases, such as mitogen-activated protein kinase and tyrosine kinases, makes it an important tool in both research and therapeutic applications.</p>

<p>KLC3 antibody was raised using the middle region of KLC3 corresponding to a region with amino acids MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL</p>

<p>Purified recombinant Human PITPNA protein</p>

<p>PLEKHA9 antibody was raised using a synthetic peptide corresponding to a region with amino acids EALLWLKRGLKFLKGFLTEVKNGEKDIQTALNNAYGKTLRQHHGWVVRGV</p>

<p>Recombinant Human DCTN6 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEB4 antibody, catalog no. 70R-4031</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP4X1 antibody, catalog no. 70R-7249</p>

<p>TMPRSS3 antibody was raised using the N terminal of TMPRSS3 corresponding to a region with amino acids MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP</p>

<p>Corticosteroid Binding Globulin (CBG) protein is a growth factor that plays a crucial role in regulating the body's response to stress and inflammation. It binds to corticosteroids, such as cortisol, in the blood, controlling their availability and activity. CBG also interacts with reactive oxygen species and antibodies, contributing to immune system function.</p>