Biochemicals and Reagents

<p>DUSP10 antibody was raised using the N terminal of DUSP10 corresponding to a region with amino acids MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFE</p>

<p>The EMA antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to fibrinogen, a glycoprotein involved in blood clotting. This antibody is produced using hybridoma cell lines, which are created by fusing immune cells with tumor cells. The resulting hybridoma cells have the ability to produce large quantities of the EMA antibody.</p>

<p>Recombinant Human tnaa protein (His tag)</p>

<p>Carboxypeptidase B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL</p>

<p>Rabbit polyclonal RNPEP antibody</p>

<p>Zfp161 antibody was raised in rabbit using the middle region of Zfp161 as the immunogen</p>

<p>The APPL1 antibody is a highly specific and potent antibody that can be used for various applications in research and diagnostics. It is available as both polyclonal and monoclonal antibodies, providing flexibility for different experimental needs.</p>

<p>1-72 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHMAG IELERCQQQA NEVTEIMRNN FGKVLERGVK LAELQQRSDQ LLDMSSTFNK TTQNLAQKKC WENIRYRIC</p>

<p>Purified recombinant PRKAB2 protein</p>

<p>The GRK2 antibody is a highly specialized protein that plays a crucial role in regulating the growth factor signaling pathway. It specifically targets trastuzumab, an EGF-like growth factor, and inhibits its activity by binding to it. This monoclonal antibody acts as a proton pump inhibitor, preventing the release of protons from collagen and thereby reducing collagen-induced cytotoxicity. Additionally, the GRK2 antibody has been shown to inhibit chemokine signaling and enhance the efficacy of other antibodies such as sorafenib and doxorubicin. In the field of life sciences, this antibody is widely used in research and development for studying TGF-beta signaling pathways. With its unique characteristics and versatile applications, the GRK2 antibody is an essential tool for scientists and researchers in various disciplines.</p>

<p>Recombinant Human ZFAND5 protein (His tag)</p>

<p>1-259 amino acids: MSKYKLIMLR HGEGAWNKEN RFCSWVDQKL NSEGMEEARN CGKQLKALNF EFDLVFTSVL NRSIHTAWLI LEELGQEWVP VESSWRLNER HYGALIGLNR EQMALNHGEE QVRLWRRSYN VTPPPIEESH PYYQEIYNDR RYKVCDVPLD QLPRSESLKD VLERLLPYWN ERIAPEVLRG KTILISAHGN SSRALLKHLE GISDEDIINI TLPTGVPILL ELDENLRAVG PHQFLGDQEA IQAAIKKVED QGKVKQAKKL EHHHHHH</p>

<p>GNAQ antibody was raised in Rabbit using Human GNAQ as the immunogen</p>

<p>Tetraspanin 17 antibody was raised using the N terminal of TSPAN17 corresponding to a region with amino acids GVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWI</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SUZ12 antibody, catalog no. 70R-7933</p>

<p>PRTFDC1 antibody was raised using the N terminal of PRTFDC1 corresponding to a region with amino acids AGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVD</p>

<p>TMEM16C antibody was raised using the C terminal of TMEM16C corresponding to a region with amino acids  AFVIAITSDYIPRFVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSEL</p>

<p>The TAU antibody is a highly specialized Polyclonal Antibody that targets and interacts with the tau protein, a key component of the neurofibrillary tangles found in Alzheimer's disease and other tauopathies. This antibody is specifically designed to recognize and bind to tau proteins in various biological samples, including brain tissue sections, cell lysates, and cerebrospinal fluid.</p>

<p>RBBP7 antibody was raised using the N terminal of RBBP7 corresponding to a region with amino acids MTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVH</p>

<p>NDST4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS</p>

<p>Conjugated Barbital-BSA hapten</p>

<p>APC protein antibody was raised in Rat using GST fusion protein having the APC region B as the immunogen.</p>

<p>The eNOS antibody is a highly specialized biomolecule that plays a crucial role in various biological processes. This glycoprotein is activated to neutralize the effects of myelin-associated glycoprotein, which is involved in nerve cell regeneration and repair. The eNOS antibody belongs to the class of polyclonal antibodies, making it highly effective in targeting specific antigens. It has been found to be particularly effective against autoantibodies that target collagen, a key component of connective tissues.</p>

<p>Rabbit polyclonal p18 INK antibody</p>

<p>MGP antibody was raised using the middle region of MGP corresponding to a region with amino acids INRRNANTFISPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERYAM</p>

<p>Purified Polyclonal Ephrin B3 antibody</p>

<p>BRDU antibody was raised in sheep using highly pure bromodeoxyuridine as the immunogen.</p>

<p>OVA conjugated Ciprofloxacin Hapten</p>

<p>KLHL20 antibody was raised in Rabbit using Human KLHL20 as the immunogen</p>

<p>MRPL23 antibody was raised in Rabbit using Human MRPL23 as the immunogen</p>

<p>SNX5 protein is a multifunctional protein that plays a crucial role in various biological processes. It has been shown to be involved in the regulation of interferon signaling, pneumococcus infection, and growth factor signaling pathways such as TGF-beta. SNX5 protein can be targeted by monoclonal antibodies, including neutralizing antibodies, which can inhibit its activity. Additionally, it has been found to interact with other proteins such as carbonic anhydrase and globulin.</p>

<p>The SORCS2 antibody is a polyclonal antibody that specifically targets the endonuclease SORCS2. This antibody recognizes and binds to the sugar moieties on SORCS2, inhibiting its activity. SORCS2 is involved in various biological processes, including growth factor signaling and regulation of microvessel density. In Life Sciences research, this antibody is commonly used to study the role of SORCS2 in different cellular pathways. It has been shown to neutralize the effects of epidermal growth factor (EGF)-like molecules and hyaluronidase in human serum. Additionally, it has been found to modulate the activity of glutamate receptors and collagen synthesis. The SORCS2 antibody is a valuable tool for researchers studying the function and regulation of this important enzyme in both normal and disease states.</p>

<p>Mouse monoclonal SNTA1 antibody</p>

<p>Rabbit polyclonal TNFAIP1 antibody</p>

<p>Mouse monoclonal PECR antibody</p>

<p>KLHDC4 antibody was raised in Rabbit using Human KLHDC4 as the immunogen</p>

<p>Purified recombinant PRKRA protein (His tag)</p>

<p>TNKS antibody was raised using the middle region of TNKS corresponding to a region with amino acids VSASLISPASTPSCLSAASSIDNLTGPLAELAVGGASNAGDGAAGTERKE</p>

<p>ZNF547 antibody was raised in rabbit using the N terminal of ZNF547 as the immunogen</p>

<p>Rabbit polyclonal SSX5 antibody</p>

<p>IFITM1 antibody was raised in Rabbit using Human IFITM1 as the immunogen</p>

<p>DHX30 antibody was raised using a synthetic peptide corresponding to a region with amino acids AESGMAPGGPGEGDGSLVNASRDLLKEFPQPKNLLNSVIGRALGISHAKD</p>

<p>SPHK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The SMAD2 antibody is a highly effective tool in the field of Life Sciences. It is an antibody that specifically targets SMAD2, a protein involved in various cellular processes. This antibody has been extensively studied and has shown to have potent protease activity, making it an ideal choice for researchers working on protease-related projects.</p>

<p>Goat anti-rat IgG (H+L) (Fab'2) (FITC) was raised in goat using rat IgG whole molecule as the immunogen.</p>

<p>THC antibody was raised in mouse using Tetrahydrocannabinol (THC)-BSA as the immunogen.</p>

<p>Rabbit polyclonal LCN2 antibody (biotin)</p>

<p>Mouse monoclonal PSMC3 antibody</p>

<p>Rabbit polyclonal MEK1 antibody (Ser298)</p>

<p>Rabbit polyclonal C1D antibody (FITC)</p>

<p>The C6 antibody is a highly activated protein that acts as an inhibitor of tumor necrosis factor-alpha (TNF-α). It is widely used in Life Sciences research for its ability to target and neutralize TNF-α, a key player in inflammation and immune response. The C6 antibody has shown promising results in various studies, including its ability to inhibit the binding of TNF-α to its receptors and reduce the production of inflammatory mediators.</p>

<p>Complement C2 antibody was raised in goat using highly purified human complement protein as the immunogen.</p>

<p>Mouse monoclonal GBP2 antibody</p>

<p>The CD80 antibody is a monoclonal antibody that targets the CD80 protein, which plays a crucial role in immune responses. It has been shown to inhibit the interaction between CD80 and its receptors, including CTLA-4 and PD-L1, leading to enhanced T-cell activation and proliferation. This antibody has been used in various studies to investigate the role of CD80 in different biological processes, such as dopamine signaling, growth factor regulation, endothelial cell growth, and cell adhesion through E-cadherin. Additionally, it has been found to modulate actin dynamics and chemokine production. The CD80 antibody has also been studied for its potential therapeutic applications in diseases like cancer and autoimmune disorders. Its unique properties make it a valuable tool for researchers in the field of Life Sciences.</p>

<p>Mouse monoclonal Cytokeratin 10+13 antibody (Prediluted for IHC)</p>

<p>IL3 beta antibody was raised in goat using highly pure recombinant rat IL-3beta as the immunogen.</p>

<p>Rabbit polyclonal CTRO antibody</p>

<p>Rabbit polyclonal PGDH3 antibody (HRP)</p>

<p>PILRA antibody was raised using the N terminal of PILRA corresponding to a region with amino acids IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN</p>

<p>DKFZP761C169 antibody was raised using the N terminal Of Dkfzp761C169 corresponding to a region with amino acids RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP</p>

<p>Rabbit polyclonal ZNF697 antibody</p>

<p>Mouse monoclonal BAIAP2 antibody</p>

<p>The Heroin antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to heroin, an opioid drug derived from morphine. This antibody can be used for various applications, including research, diagnostics, and therapeutic purposes.</p>

<p>PRELP antibody was raised using the middle region of PRELP corresponding to a region with amino acids SNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSH</p>

<p>LONRF3 antibody was raised using the middle region of LONRF3 corresponding to a region with amino acids LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF560 antibody, catalog no. 70R-8135</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCMTD1 antibody, catalog no. 70R-1075</p>

<p>Calponin 2 antibody was raised using the N terminal of CNN2 corresponding to a region with amino acids YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC</p>

<p>Purified Polyclonal M Cadherin antibody</p>

<p>KIF22 antibody was raised in mouse using recombinant Human Kinesin Family Member 22 (Kif22)</p>

<p>RFPL3 antibody was raised using the C terminal of RFPL3 corresponding to a region with amino acids TVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPL</p>

<p>Rabbit polyclonal GNAL antibody</p>

<p>Phenobarbital antibody was raised in mouse using phenobarbital-KLH conjugate as the immunogen.</p>

<p>Purified recombinant PSMB8 protein</p>

<p>Rabbit Polyclonal EPS15L1 antibody</p>

<p>Mouse monoclonal SCHIP1 antibody</p>

<p>Mouse monoclonal C17orf37 antibody</p>

<p>Mouse monoclonal CD5 antibody (FITC)</p>

<p>TUJ1 antibody was raised in rabbit using residues 433-450 EGEMYEDDEEESEAQGPK of the 50 kDa human beta-tubulin-III protein as the immunogen.</p>

<p>MIS12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLTFFDELHNVGRDHGTSDFRESLVSLVQNSRKLQNIRDNVEKESKRLKI</p>

<p>GSTA3 antibody was raised in Rabbit using Human GSTA3 as the immunogen</p>

<p>Rabbit polyclonal MMP15 antibody (Tyr132)</p>

<p>1-132 amino acids: MGSSHHHHHH SSGLVPRGSH MAFDSTWKVD RSENYDKFME KMGVNIVKRK LAAHDNLKLT ITQEGNKFTV KESSAFRNIE VVFELGVTFN YNLADGTELR GTWSLEGNKL IGKFKRTDNG NELNTVREII GDELVQTYVY EGVEAKRIFK KD</p>

<p>MDC antibody was raised in rabbit using highly pure recombinant murine MDC as the immunogen.</p>

<p>Synapsin 1 antibody is a highly specialized Polyclonal Antibody that plays a crucial role in endothelial growth and development. This antibody is widely used in the field of Life Sciences to study various cellular processes and identify specific cell antigens. The high viscosity of this antibody ensures efficient binding to target molecules, providing accurate and reliable results.</p>

<p>Sepimostat dimethanesulfonate is a peptide that acts as an inhibitor of ion channels and receptor proteins. It is used as a research tool for the study of protein interactions, cell biology, and pharmacology. Sepimostat dimethanesulfonate binds to receptors and ligands with high affinity, preventing them from binding to their corresponding proteins. This drug has been shown to inhibit the activity of potassium channels and calcium channels in cells.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ST8SIA2 antibody, catalog no. 70R-7133</p>

<p>Purified Polyclonal EPB41L2 antibody</p>

<p>The Mouse IgG2a Isotype Control is a monoclonal antibody that serves as an isotype control for experimental purposes. It is used in various life science research applications to ensure accurate and reliable results. This isotype control does not specifically bind to any antigen or target, making it an ideal control for experiments involving antibodies.</p>

<p>Adenovirus antibody was raised in mouse using hexon group antigen of numerous ADV as the immunogen.</p>

<p>The BclxL antibody is a monoclonal antibody that belongs to the class of anti-acth antibodies. It is widely used in Life Sciences research for its ability to detect and target the BclxL protein, a key regulator of apoptosis. This antibody has been shown to exhibit cytotoxic activity against cancer cells by inducing apoptosis through the inhibition of BclxL function. Additionally, it has been found to have inhibitory effects on chemokine and TGF-beta signaling pathways, which play crucial roles in inflammation and immune response. The BclxL antibody can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. Its high specificity and affinity make it a valuable tool for studying the role of BclxL in cell survival and growth regulation.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is widely recognized as one of the most effective treatments for tuberculosis infections. This compound exhibits strong bactericidal activity by binding to DNA-dependent RNA polymerase, thus inhibiting bacterial growth and replication. The effectiveness of this drug has been demonstrated through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets Mycobacterium tuberculosis strains and impedes their cell growth in culture.</p>

<p>Purified Polyclonal ZNF25 antibody</p>

<p>PAM antibody was raised using the N terminal of PAM corresponding to a region with amino acids PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL</p>

<p>The GFP antibody is an essential tool in Life Sciences research. It is a monoclonal antibody that specifically binds to Green Fluorescent Protein (GFP), a protein commonly used as a molecular marker in various experimental techniques. This antibody has been extensively validated for its high specificity and sensitivity in detecting GFP-tagged proteins.</p>

<p>SPAG11B antibody was raised using the N terminal of SPAG11B corresponding to a region with amino acids MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNG</p>

<p>The PECAM1 antibody is a highly specialized monoclonal antibody derived from a hybridoma cell line. It is designed to target and neutralize the growth factor receptor protein known as platelet endothelial cell adhesion molecule 1 (PECAM1). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Mouse monoclonal LEMD3 antibody</p>

<p>Rabbit polyclonal SLC26A3 antibody</p>

<p>HIV1 antibody (HTLV3) was raised in goat using human isolate, highly pure HIV1 as the immunogen.</p>