Biochemicals and Reagents

<p>The DDX3 antibody is a monoclonal antibody that specifically targets the DDX3 protein. It has been widely used in life sciences research to study various biological processes, including receptor binding, antigen binding, and protein-protein interactions. The DDX3 antibody can also be used as a diagnostic tool for detecting the presence of DDX3 in samples.</p>

<p>The GST antibody is a monoclonal antibody that specifically targets glutathione S-transferase (GST). It is widely used in life sciences research and various assays. This antibody can be used to detect the presence of GST in samples, making it a valuable tool for studying the role of GST in cellular processes. Additionally, the GST antibody has been shown to have cytotoxic effects on cancer cells expressing annexin A2, suggesting its potential as a therapeutic agent. With its high specificity and sensitivity, this antibody is an essential component for researchers studying insulin and glucagon signaling pathways, as well as other areas of interest in the field of life sciences.</p>

<p>The Connexin 43 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to Connexin 43, a protein involved in cell-to-cell communication. This antibody has been extensively studied and proven to be effective in various applications.</p>

<p>Rabbit polyclonal RM34 antibody</p>

<p>POLB antibody was raised using a synthetic peptide corresponding to a region with amino acids GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML</p>

<p>MAPRE2 antibody was raised in Rabbit using Human MAPRE2 as the immunogen</p>

<p>The PROM2 antibody is a highly specialized monoclonal antibody that targets the collagen protein. It has been extensively studied in the field of Life Sciences for its role in various biological processes. This antibody specifically recognizes and binds to PROM2, a protein that is involved in the regulation of alpha-fetoprotein, globulin, and albumin levels.</p>

<p>The HAO1 antibody is a nuclear autoantibody that belongs to the class of Monoclonal Antibodies. It specifically targets the octanoyltransferase and methyl transferase enzymes, which are involved in high-flux metabolic pathways. This antibody has been extensively studied as a biomarker for various diseases and conditions, including interleukin disorders and carnitine deficiencies. The HAO1 antibody is used in research and diagnostic assays to detect the presence of these enzymes and their inhibitors. Its high specificity and sensitivity make it an essential tool in the field of Life Sciences.</p>

<p>CACNA1I antibody was raised using the middle region of CACNA1I corresponding to a region with amino acids LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS</p>

<p>The Glucagon antibody is a monoclonal antibody that has been developed for use in bioassays and immunoassays. It specifically targets the antigen binding domain of lipoprotein lipase, an enzyme involved in lipid metabolism. This monoclonal antibody is highly reactive and has been extensively studied in Life Sciences research.</p>

<p>ZNF12 antibody was raised in rabbit using the N terminal of ZNF12 as the immunogen</p>

<p>PSA antibody was raised in mouse using human seminal fluid PSA as the immunogen.</p>

<p>KRR1 antibody was raised using the C terminal of KRR1 corresponding to a region with amino acids KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTET</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1191 antibody, catalog no. 70R-4315</p>

<p>ERCC5 antibody was raised using the N terminal of ERCC5 corresponding to a region with amino acids NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ</p>

<p>SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF</p>

<p>Abcc2 antibody was raised in rabbit using the middle region of Abcc2 as the immunogen</p>

<p>Mouse monoclonal MRPS25 antibody</p>

<p>JE MCP1 antibody was raised in rabbit using highly pure recombinant JE(MCP-1) as the immunogen.</p>

<p>The INSR antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the insulin receptor (INSR) protein, which plays a crucial role in cellular signaling and glucose metabolism. This antibody can be used to study various aspects of INSR function, including its interaction with other proteins such as telomerase, glucagon, β-catenin, and collagen.</p>

<p>Rabbit Polyclonal eNOS antibody (Ser615)</p>

<p>Purified Rabbit polyclonal OR8H2 antibody</p>

<p>CSF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP</p>

<p>Purified Polyclonal Fibulin 1 antibody</p>

<p>PSMD11 antibody was raised in mouse using recombinant human PSMD11 (1-422aa) purified from E. coli as the immunogen.</p>

<p>KRR1 antibody was raised in Rabbit using Human KRR1 as the immunogen</p>

<p>Albumin antibody was raised using the middle region of ALB corresponding to a region with amino acids LSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKE</p>

<p>RAP1GAP antibody was raised using the middle region of RAP1GAP corresponding to a region with amino acids IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA</p>

<p>SLC25A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLKPAGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKF</p>

<p>1-197 amino acids: MQRASRLKRE LHMLATEPPP GITCWQDKDQ MDDLRAQILG GANTPYEKGV FKLEVIIPER YPFEPPQIRF LTPIYHPNID SAGRICLDVL KLPPKGAWRP SLNIATVLTS IQLLMSEPNP DDPLMADISS EFKYNKPAFL KNARQWTEKH ARQKQKADEE EMLDNLPEAG DSRVHNSTQK RKASQLVGIE KKFHPDVLEH HHHHH</p>

<p>Purified recombinant Human C4BPB protein (His tag)</p>

<p>The ST3GAL4 antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to the ST3GAL4 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in applications such as immunohistochemistry, immunofluorescence, Western blotting, and flow cytometry.</p>

<p>The Alkaline Phosphatase antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the alkaline phosphatase enzyme, which plays a crucial role in various biological processes such as glycosylation, exocytosis, and nuclear signaling. This antibody binds to the active site of alkaline phosphatase and inhibits its activity, allowing researchers to study the effects of its inhibition on cellular functions.</p>

<p>HSPC111 antibody was raised using the middle region of HSPC111 corresponding to a region with amino acids RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR</p>

<p>Rabbit polyclonal HS71L antibody</p>

<p>Rabbit polyclonal THOC7 antibody</p>

<p>IGSF1 antibody was raised using the middle region of IGSF1 corresponding to a region with amino acids TMAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGGCGYGC</p>

<p>16:0-16:0-d31 Pc is a synthetic peptide that is used as an inhibitor of 16:0-16:0 binding to the receptor. The peptide has been shown to bind to the ligand binding domain in the extracellular loop of the receptor and prevent it from activating the ion channels. This peptide is also used as a research tool for studying protein interactions, and can be used in pharmacology, life science, and cell biology.</p>

<p>The USP7 antibody is a monoclonal antibody that specifically binds to the receptor for colony-stimulating factor (CSF). This antibody has been shown to have cytotoxic effects on cells that express high levels of the CSF receptor, making it a promising therapeutic option in the field of life sciences. The USP7 antibody works by neutralizing the activity of CSF, which is a growth factor involved in cell proliferation and differentiation. By blocking the binding of CSF to its receptor, this antibody inhibits the downstream signaling pathways that promote cell growth and survival. Additionally, the USP7 antibody has been found to interact with calmodulin and form dimers, which further enhances its cytotoxic effects. With its ability to selectively target activated cells expressing high levels of the CSF receptor, this monoclonal antibody holds great potential for targeted therapy in various diseases.</p>

<p>The beta Actin antibody is a highly specific monoclonal antibody that targets the beta-actin protein. It is widely used in research and diagnostic applications to detect and quantify the expression levels of beta-actin in various samples, including human serum. This antibody has been proven to be cytotoxic towards cells expressing sclerostin, an antigen associated with bone disorders. The beta Actin antibody can be used in a variety of assays, including Western blotting, immunohistochemistry, and flow cytometry, to study the localization and function of beta-actin in different cellular contexts. Its high specificity and sensitivity make it an indispensable tool for researchers studying cellular processes such as cell motility, cytoskeletal dynamics, and intracellular signaling pathways involving beta-actin.</p>

<p>The Beta catenin antibody is a highly versatile antibody that plays a crucial role in various biological processes. It is commonly used in life sciences research, particularly in the field of pluripotent stem cells. This antibody specifically targets β-catenin, a protein that is involved in cell adhesion and signaling pathways.</p>

<p>CD45RO Monoclonal Antibody (HRP)</p>

<p>CACYBP antibody is a serum marker used in Life Sciences to detect the presence of dopamine. It is commonly used in research involving pluripotent stem cells. This antibody specifically targets CACYBP, a protein involved in various cellular processes. The CACYBP antibody can be used for chromatographic and immunological assays to study the activation and function of CACYBP. It can also be used as a diagnostic tool to detect autoantibodies associated with certain diseases. Additionally, this antibody can be used in the development of monoclonal antibodies or other therapeutic agents targeting CACYBP. Its application extends to studies involving methyl transferase activity, interferon-stimulated gene expression, acetylcholine signaling, and transmembrane conductance.</p>

<p>TAAR5 antibody was raised in rabbit using the C terminal of TAAR5 as the immunogen</p>

<p>Rabbit polyclonal SDP3 antibody (HRP)</p>

<p>EGFR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>MMP9 antibody was raised in rabbit using residues 540-552 [WRFSEGRGSRPQG] of the 92 kDa human MMP9 protein as the immunogen.</p>

<p>Rabbit Polyclonal GPT antibody (biotin)</p>

<p>Rabbit polyclonal SCN2B antibody</p>

<p>The MAP2K2 antibody is a highly effective monoclonal antibody that has neutralizing properties. It acts by targeting and inhibiting the activity of MAP2K2, a protein involved in cellular signaling pathways. This antibody is particularly useful in studies involving antibodies, autoantibodies, interferon, and colony-stimulating factors. It has been extensively tested on various cell lines, including MCF-7 cells, and has shown excellent results in blocking the activity of MAP2K2. Additionally, this antibody has been found to have inhibitory effects on antiphospholipid antibodies and other factors that contribute to disease progression. With its high specificity and potency, the MAP2K2 antibody is an invaluable tool for researchers studying signal transduction pathways and developing targeted therapies.</p>

<p>SLC25A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids AATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQL</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>H2AFY antibody was raised using the middle region of H2AFY corresponding to a region with amino acids PVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLG</p>

<p>Mouse monoclonal CHEK2 antibody</p>

<p>ERK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal GPR157 antibody</p>

<p>Recombinant Human CCBL1 protein with His tag</p>

<p>The p300 antibody is a highly specialized antibody that is commonly used in the field of Life Sciences. It is an acidic, polyclonal antibody that targets specific proteins involved in various cellular processes. This antibody has been extensively studied and shown to have neutralizing and inhibitory effects on certain factors, making it a valuable tool for researchers.</p>

<p>FAM3C antibody was raised using the C terminal of FAM3C corresponding to a region with amino acids DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD</p>

<p>ApoA1 protein is a versatile protein that plays a crucial role in various biological processes. It is a protein polymer that acts as a lipid synthesis inhibitor and is involved in the regulation of cholesterol metabolism. This protein has been extensively studied in the field of Life Sciences, where it has been identified as a potential biomarker for various diseases.</p>

<p>The SERPINB2 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to SERPINB2, an acidic protein found in human serum. This antibody has been shown to be highly effective in detecting and quantifying the levels of SERPINB2 in various biological samples.</p>

<p>Purified recombinant FSBP protein (His tag)</p>

<p>Mouse monoclonal MYL4 antibody</p>

<p>C1QTNF4 antibody was raised in Rabbit using Human C1QTNF4 as the immunogen</p>

<p>MAGEA11 antibody was raised in rabbit using the middle region of MAGEA11 as the immunogen</p>

<p>Purified Polyclonal AMD1 antibody</p>

<p>The EPHB3 antibody is a highly specialized cytotoxic agent that targets the EPHB3 receptor. This receptor plays a crucial role in cell signaling pathways, including phosphatase and TNF-related apoptosis-inducing ligand (TRAIL) pathways. By binding to the EPHB3 receptor, this antibody inhibits its activity, leading to decreased cell growth and survival.</p>

<p>IMP3 antibody was raised in Rabbit using Human IMP3 as the immunogen</p>

<p>Rabbit polyclonal DJ1 antibody (biotin)</p>

<p>Rabbit polyclonal SMC5 antibody</p>

<p>FH antibody is a monoclonal antibody that specifically targets nuclear β-catenin, which is involved in various cellular processes. This antibody can be used in bioassays to study the role of β-catenin in different biological systems. FH antibody has been shown to have inhibitory effects on steroid production and can be used as a tool for studying steroidogenesis. In addition, this antibody has potential applications in the field of life sciences for the development of therapeutic antibodies or inhibitors targeting specific proteins or pathways. FH antibody also shows binding affinity to collagen and plasticizers, making it useful for applications involving these materials. Furthermore, FH antibody has been studied for its potential use in treating choroidal neovascularization and androgen-related disorders.</p>

<p>C20ORF116 antibody was raised using the middle region of C20Orf116 corresponding to a region with amino acids EERKRLESQREAEWKKEEERLRLEEEQKEEEERKAREEQAQREHEEYLKL</p>

<p>Rabbit polyclonal ACTA1 antibody (FITC)</p>

<p>CDC45L antibody was raised using a synthetic peptide corresponding to a region with amino acids VTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRMLHNHFDLSVIELKAED</p>

<p>VZV protein is a key component in Life Sciences, specifically in the field of Proteins and Antigens. It plays a crucial role in various biological processes and has been extensively studied for its potential therapeutic applications. VZV protein has shown promising results in research involving ranolazine, where it was found to modulate the expression of messenger RNA (mRNA) associated with cardiac function. Additionally, VZV protein has been used for immobilization studies on electrodes, enabling ultrasensitive detection of dopamine and natriuretic peptides in human serum. Its neutralizing properties make it an ideal candidate for the development of monoclonal antibodies and DNA vaccines targeting specific pathogens. With its diverse range of applications, VZV protein continues to be at the forefront of cutting-edge research in the field of Life Sciences.</p>

<p>PHOSPHO2 antibody was raised in rabbit using the N terminal of PHOSPHO2 as the immunogen</p>

<p>5-Methyl cytosine antibody was raised in sheep using 5-methyl cytosine as the immunogen.</p>

<p>The UQCRC2 antibody is a potent antifibrotic agent that works by targeting and lysing specific cells involved in fibrosis. This monoclonal antibody has been extensively studied and validated using polymerase chain techniques, demonstrating its high specificity and efficacy. It has also been shown to effectively neutralize autoantibodies and inhibit the activation of mesenchymal stem cells, which play a crucial role in fibrotic processes. The UQCRC2 antibody specifically targets atypical hemolytic cells by binding to their surface receptors, leading to their destruction. Additionally, this antibody can be used for immunohistochemical detection of protein complexes, such as serine proteases or amyloid plaques, making it a valuable tool for research and diagnostic purposes. Available as both polyclonal and monoclonal antibodies, the UQCRC2 antibody offers a versatile solution for various applications in the field of immunology.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. The drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high efficacy on human erythrocytes using a patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Rifapentine also specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Purified recombinant KLK1 protein (His tag)</p>

<p>Rabbit polyclonal SLC25A11 antibody</p>

<p>Mouse PMN antibody was raised in rabbit using murine PMNs as the immunogen.</p>

<p>PDE3A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>JUNB antibody was raised in mouse using recombinant Human Jun B Proto-Oncogene</p>

<p>Rabbit polyclonal TCTN1 antibody</p>

<p>Mouse monoclonal Rubeola virus antibody</p>

<p>LSM4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGK</p>

<p>Chk1 antibody is a highly specific and sensitive antibody that can be used for various applications in the field of life sciences. This antibody specifically targets the Chk1 protein, which plays a crucial role in cell cycle regulation and DNA damage response. It has been extensively validated for its performance in techniques such as immunohistochemistry, Western blotting, and immunofluorescence.</p>

<p>Rabbit polyclonal KCNN4 antibody</p>

<p>Rabbit polyclonal SLC25A4 antibody</p>

<p>The FABP antibody is a monoclonal antibody that specifically targets fatty acid binding proteins (FABPs). FABPs are involved in the transportation and metabolism of fatty acids within cells. This antibody can be used for various applications, including research studies on the role of FABPs in cellular processes, as well as diagnostic tests for certain diseases.</p>

<p>Rabbit polyclonal PYGB antibody (FITC)</p>

<p>D-dimer antibody is a monoclonal antibody used in the field of Life Sciences for various applications. It has been extensively studied and proven to be effective in detecting D-dimer, a fibrin degradation product that is elevated in blood plasma during thrombotic events. This antibody can be used in electrochemical biosensing techniques, such as electrochemical impedance spectroscopy and chemiluminescence immunoassay, to accurately measure D-dimer levels. The D-dimer antibody is immobilized on a carbon electrode or colloidal gold surface, allowing for specific binding with D-dimer molecules present in the sample. Its high selectivity and sensitivity make it an ideal tool for diagnosing and monitoring thrombotic disorders. Additionally, this antibody has shown promising antioxidant activity, making it a potential candidate for further research in the field of lipid composition and estradiol level regulation.</p>

<p>HIV1 gp120 antibody was raised in rabbit using full length recombinant gp120 (HIV-1) as the immunogen.</p>

<p>The SORCS2 antibody is a polyclonal antibody that specifically targets the endonuclease SORCS2. This antibody recognizes and binds to the sugar moieties on SORCS2, inhibiting its activity. SORCS2 is involved in various biological processes, including growth factor signaling and regulation of microvessel density. In Life Sciences research, this antibody is commonly used to study the role of SORCS2 in different cellular pathways. It has been shown to neutralize the effects of epidermal growth factor (EGF)-like molecules and hyaluronidase in human serum. Additionally, it has been found to modulate the activity of glutamate receptors and collagen synthesis. The SORCS2 antibody is a valuable tool for researchers studying the function and regulation of this important enzyme in both normal and disease states.</p>

<p>Mouse monoclonal SNTA1 antibody</p>

<p>Rabbit polyclonal TNFAIP1 antibody</p>

<p>Mouse monoclonal PECR antibody</p>

<p>KLHDC4 antibody was raised in Rabbit using Human KLHDC4 as the immunogen</p>

<p>Purified recombinant PRKRA protein (His tag)</p>