Biochemicals and Reagents

<p>FMNL1 antibody was raised in mouse using recombinant Human Formin-Like 1</p>

<p>TFG antibody is a monoclonal antibody that specifically targets amyloid plaque, a hallmark of various neurodegenerative diseases. This antibody recognizes and binds to the TFG glycoprotein, which is present in amyloid plaques. By binding to these plaques, the TFG antibody helps to clear them from the brain and reduce their accumulation.</p>

<p>Mouse monoclonal WWTR1 antibody</p>

<p>Rabbit polyclonal EPHA2/3/4 antibody (Tyr588/596)</p>

<p>CD29 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>PILRB antibody was raised using the middle region of PILRB corresponding to a region with amino acids KLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALA</p>

<p>Rabbit polyclonal COX11 antibody</p>

<p>Ubiquilin 4 antibody was raised using the middle region of UBQLN4 corresponding to a region with amino acids TDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPS</p>

<p>Claudin 18 antibody was raised using the middle region of CLDN18 corresponding to a region with amino acids LVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMM</p>

<p>SIGLEC9 antibody was raised using the C terminal of SIGLEC9 corresponding to a region with amino acids PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA</p>

<p>Purified Polyclonal CK2 beta antibody</p>

<p>Rabbit anti-mouse IgG2a (Rhodamine) was raised in rabbit using murine IgG2a heavy chain as the immunogen.</p>

<p>Warfarin Conjugate for use in immunoassays</p>

<p>Purified Rabbit polyclonal BORG4 antibody</p>

<p>The RGS2 antibody is a powerful tool in the field of Life Sciences. This antibody is designed to target and inhibit the activity of RGS2, a protein involved in various cellular processes. By binding to RGS2, this antibody effectively blocks its function, leading to a cascade of downstream effects.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NOC3L antibody, catalog no. 70R-3436</p>

<p>MYL4 antibody was raised in Rabbit using Human MYL4 as the immunogen</p>

<p>DRG1 antibody was raised using the middle region of DRG1 corresponding to a region with amino acids VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL</p>

<p>Rabbit polyclonal RANGRF antibody</p>

<p>Purified recombinant WWC1 protein (His tag)</p>

<p>The EDG1 antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. It has been extensively studied for its ability to target and inhibit the activity of EDG1, a receptor involved in angiogenesis and vascular development. By binding to EDG1, this antibody effectively reduces microvessel density and protease activity, thereby inhibiting the growth factor-mediated formation of new blood vessels.</p>

<p>WARS antibody was raised using the N terminal of WARS corresponding to a region with amino acids EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF</p>

<p>Synaptopodin antibody was raised in mouse using rat kidney glomeruli as the immunogen.</p>

<p>Plakophilin 2 Monoclonal Antibody BSA/Azide Free</p>

<p>Mouse monoclonal KATNB1 antibody</p>

<p>POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids KINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQL</p>

<p>Rabbit polyclonal TAF12 antibody</p>

<p>Rabbit polyclonal THOC1 antibody</p>

<p>The CDK2 antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets cyclin-dependent kinase 2 (CDK2), an important protein involved in cell cycle regulation. This antibody is commonly used for various applications such as immunoprecipitation, Western blotting, and immunofluorescence.</p>

<p>KLK-L4 antibody was raised in rabbit using residues 262-277 [IRKYETQQQKWLKGPQ] of the human KLK-L4 protein as the immunogen.</p>

<p>Goat anti-Bovine IgG (H + L) (HRP) was raised in goat using purified Bovine IgG (H&amp;L) as the immunogen.</p>

<p>RELB antibody was raised in rabbit using the middle region of RELB as the immunogen</p>

<p>The CSFR antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the colony-stimulating factor receptor (CSFR), which plays a crucial role in cell growth and differentiation. This antibody can be used for various applications, including immunohistochemistry, flow cytometry, and Western blotting.</p>

<p>FICD antibody was raised using the C terminal of FICD corresponding to a region with amino acids GDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP</p>

<p>KIR2DL3 antibody was raised in Rabbit using Human KIR2DL3 as the immunogen</p>

<p>HIBADH antibody was raised using the middle region of HIBADH corresponding to a region with amino acids WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL</p>

<p>The GFAP antibody is a polyclonal antibody that specifically targets glial fibrillary acidic protein (GFAP). It is commonly used in the field of Life Sciences for various research applications. This antibody recognizes and binds to GFAP, which is an intermediate filament protein found mainly in astrocytes. By targeting GFAP, researchers can study the role of astrocytes in different physiological and pathological conditions.</p>

<p>Mouse monoclonal CST4 antibody</p>

<p>ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids SFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLK</p>

<p>The TRIM33 antibody is a highly specialized antibody that targets glial fibrillary acidic protein (GFAP). It is commonly used in the field of Life Sciences for various applications such as immunoassays, immunohistochemistry, and western blotting. This monoclonal antibody specifically recognizes and binds to GFAP, allowing for the detection and quantification of this protein in different biological samples.</p>

<p>Mouse monoclonal CD95 antibody (biotin)</p>

<p>Rabbit polyclonal KCNQ3 antibody (Thr246)</p>

<p>The FPR1 antibody is a highly specific and potent polyclonal antibody that targets the FPR1 receptor. This receptor plays a crucial role in various physiological processes, including natriuretic and viscosity regulation. The FPR1 antibody has been shown to have neutralizing effects on histamine H4 receptors, which are involved in allergic reactions and inflammation. Additionally, this antibody has been found to interact with fatty acids and modulate their signaling pathways. The FPR1 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. It has been extensively studied in adipose tissue research, where it has demonstrated its ability to inhibit CDK4/6 activity and suppress the proliferation of adipocytes. Furthermore, the FPR1 antibody has shown promising results in preclinical studies targeting interleukin-6 (IL-6) signaling and transthyretin (TTR) amyloidosis. With its antiestrogen properties,</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Extensive research has been conducted using a patch-clamp technique on human erythrocytes to demonstrate its high efficacy. The metabolization of this drug involves various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Purified recombinant IRGM protein</p>

<p>The EPHA3 antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody is designed to target and bind to the EPHA3 receptor, which plays a crucial role in various cellular processes. By binding to this receptor, the EPHA3 antibody can effectively inhibit its activation and downstream signaling pathways.</p>

<p>KRT18 antibody was raised in Rabbit using Human KRT18 as the immunogen</p>

<p>The PDGFR alpha antibody is a glycoprotein that acts as an antigen and is specifically activated by TNF-related apoptosis-inducing ligand (TRAIL). It has cytotoxic effects on cells and has been shown to interact with fibrinogen and human mitochondrial protein. The PDGFR alpha antibody is a crucial component in various assays used to detect and study active molecules. It is widely used in the field of Life Sciences, particularly in antibody-based research. With its high specificity and affinity, this antibody plays a vital role in understanding cellular processes and developing targeted therapies.</p>

<p>Rabbit polyclonal KCND2 antibody (Ser616)</p>

<p>Rabbit polyclonal cJun antibody</p>

<p>Mouse monoclonal Troponin I antibody (Skeletal Muscle)</p>

<p>Rabbit polyclonal GZ alpha antibody</p>

<p>Pirlimycin Conjugate for use in immunoassays</p>

<p>Purified Parainfluenza type 3 protein</p>

<p>Chymotrypsin-Like antibody was raised using the N terminal of CTRL corresponding to a region with amino acids LLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL</p>

<p>The CD80 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody targets the fatty acid present on the virus surface antigen, neutralizing its activity. The CD80 antibody forms dimers that bind to amyloid plaque, preventing its accumulation and promoting its clearance. Additionally, this antibody has been shown to inhibit the action of glucagon, a hormone involved in glucose regulation. The CD80 antibody is a glycoprotein with colloidal properties, allowing for easy dispersion and administration. It also exhibits superoxide scavenging activity and modulates interleukin production. With its high specificity and affinity, the CD80 antibody is an essential component in research and therapeutic applications involving serine proteases.</p>

<p>Rabbit polyclonal RASSF6 antibody</p>

<p>HMGB1 antibody was raised in mouse using recombinant human HMGB1 (1-215aa) purified from Trichoplusia ni insect cells as the immunogen.</p>

<p>p8 antibody was raised in rabbit using N terminus of the human p8 protein as the immunogen.</p>

<p>1-282 amino acids: MGSSHHHHHH SSGLVPRGSH MALKQISSNK CFGGLQKVFE HDSVELNCKM KFAVYLPPKA ETGKCPALYW LSGLTCTEQN FISKSGYHQS ASEHGLVVIA PDTSPRGCNI KGEDESWDFG TGAGFYVDAT EDPWKTNYRM YSYVTEELPQ LINANFPVDP QRMSIFGHSM GGHGALICAL KNPGKYKSVS AFAPICNPVL CPWGKKAFSG YLGTDQSKWK AYDATHLVKS YPGSQLDILI DQGKDDQFLL DGQLLPDNFI AACTEKKIPV VFRLQEDYDH SYYFIATFIT DHIRHHAKYL NA</p>

<p>Mouse monoclonal NPR3 antibody</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>Rat monoclonal IgM antibody (FITC)</p>

<p>The DROSHA antibody is a highly versatile and powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to DROSHA, a protein involved in the processing of microRNAs. This antibody has been extensively used in research studies to investigate the role of DROSHA in various cellular processes.</p>

<p>The SPI1 antibody is a high-quality polyclonal antibody that specifically targets biomolecules involved in various biological processes. It has been extensively tested and validated for its specificity and reliability. This antibody shows excellent binding affinity towards tumor necrosis factor-alpha (TNF-α), interleukin-6 (IL-6), ornithine, monoclonal antibodies, haloperidol, mineralocorticoid receptor, teriparatide, dopamine, glycosylation, interferon, and other important proteins.</p>

<p>Rabbit polyclonal HNRPDL antibody</p>

<p>Rabbit polyclonal RPS12 antibody</p>

<p>ZNF587 antibody was raised in rabbit using the middle region of ZNF587 as the immunogen</p>

<p>Armenian Hamster monoclonal FceRI alpha antibody (PE)</p>

<p>Mouse monoclonal CD80 antibody (PE)</p>

<p>HMGN1 antibody was raised in Rabbit using Human HMGN1 as the immunogen</p>

<p>Mouse monoclonal NUDT6 antibody</p>

<p>HMGB4 antibody was raised in rabbit using the N terminal of HMGB4 as the immunogen</p>

<p>Rat monoclonal B7RP1 antibody (biotin)</p>

<p>Purified Polyclonal FOXR1 antibody</p>

<p>The PRL antibody is a nuclear monoclonal antibody that targets the growth factor prolactin (PRL). It is commonly used in Life Sciences research to study the role of PRL in various physiological processes. This antibody specifically recognizes and binds to PRL, allowing for the detection and quantification of PRL levels in biological samples such as human serum or tissue extracts. The PRL antibody can be used in techniques like immunohistochemistry, ELISA, or Western blotting to investigate the expression and localization of PRL in different tissues or cell types. By blocking the interaction between PRL and its receptor, this antibody can also be used as a tool to study the functional consequences of inhibiting PRL signaling pathways. With its high specificity and affinity for PRL, the PRL antibody is an essential tool for researchers studying adipose biology, growth factors, or investigating potential therapeutic targets for conditions related to dysregulated PRL signaling.</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>Tetraspanin 8 antibody was raised using the middle region of TSPAN8 corresponding to a region with amino acids VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNG</p>

<p>Purified recombinant MIA protein (His tag)</p>

<p>Purified recombinant CCL5 protein (His tag)</p>

<p>1-196 amino acids: MGSSHHHHHH SSGLVPRGSH MADGQMPFSC HYPSRLRRDP FRDSPLSSRL LDDGFGMDPF PDDLTASWPD WALPRLSSAW PGTLRSGMVP RGPTATARFG VPAEGRTPPP FPGEPWKVCV NVHSFKPEEL MVKTKDGYVE VSGKHEEKQQ EGGIVSKNFT KKIQLPAEVD PVTVFASLSP EGLLIIEAPQ VPPYSTFGES SFNNELPQDS QEVTCT</p>

<p>Rabbit polyclonal p130 Cas antibody (Tyr410)</p>

<p>Rnf122 antibody was raised in rabbit using the middle region of Rnf122 as the immunogen</p>

<p>Mouse monoclonal hIST1 antibody</p>

<p>Purified Polyclonal HEXB antibody</p>

<p>G6PD antibody was raised in mouse using recombinant human G6PD (35-506aa) purified from E. coli as the immunogen.</p>

<p>OVA conjugated Sulfadimethoxine Hapten</p>

<p>The Doublecortin antibody is a highly specialized product that belongs to the category of Polyclonal Antibodies. It is designed to target and bind to the doublecortin protein, which plays a crucial role in neurogenesis and neuronal migration. This antibody can be used in various research applications, including immunohistochemistry, western blotting, and immunofluorescence.</p>

<p>The ANXA3 antibody is a highly specific monoclonal antibody that targets the Annexin A3 protein. This protein is involved in various cellular processes, including transferrin binding, amyloid plaque formation, and regulation of alpha-fetoprotein levels. The ANXA3 antibody can be used in research and diagnostic applications to detect the presence and localization of Annexin A3 in different tissues and biological samples.</p>

<p>MARS antibody was raised in mouse using recombinant Methionine-Trna Synthetase</p>

<p>HSF5 antibody was raised in Rabbit using Human HSF5 as the immunogen</p>

<p>Cadherin 6 antibody was raised in mouse using GST fusion protein of part of the extracellular domain of cadherin 6 (K-Cadherin) as the immunogen.</p>

<p>RNF39 antibody was raised using the N terminal of RNF39 corresponding to a region with amino acids EGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVTVVAEGAASRSWLSMD</p>

<p>The TSC1 antibody is a highly specific polyclonal antibody that is used in various research applications. It has been shown to bind to erythropoietin (EPO) and human serum, allowing for the immobilization of these proteins on an electrode surface. The TSC1 antibody can also be used to detect androgen receptors in different tissues and histidine-tagged proteins in various immunoassays.</p>

<p>The P2RY5 antibody is a powerful growth factor that plays a crucial role in various biological processes. It acts as an electrode, neutralizing any harmful substances and promoting healthy cell growth. This antibody also interacts with lipoprotein lipase, which aids in the breakdown of fatty acids for energy production.</p>

<p>FOLR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARF</p>

<p>The CYP2J2 antibody is a powerful tool in the field of Life Sciences. It has antiviral properties and can be used to study various biological processes. This antibody specifically targets CYP2J2, an enzyme involved in the metabolism of drugs and other compounds. It can be used to inhibit the activity of CYP2J2 and study its role in different cellular pathways.</p>

<p>KLHDC4 antibody was raised using the N terminal of KLHDC4 corresponding to a region with amino acids MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEEDLEALIAHFQTLDAKR</p>

<p>Rat monoclonal CD90.2 antibody (biotin)</p>

<p>ADSL antibody was raised in rabbit using the middle region of ADSL as the immunogen</p>