Biochemicals and Reagents

<p>FAM81B antibody was raised using the N terminal of FAM81B corresponding to a region with amino acids MQLQFLGTLASSEKRKKSQRLFFKNIKSTKNKAGKASIMSSDTNVNKSAS</p>

<p>CKMT2 antibody was raised in Rabbit using Human CKMT2 as the immunogen</p>

<p>Rabbit polyclonal CLPT1 antibody</p>

<p>Complement C2 antibody was raised using the middle region of C2 corresponding to a region with amino acids INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ</p>

<p>The Src antibody is a highly specialized monoclonal antibody that targets protein kinases, specifically those involved in Life Sciences research. This antibody acts as an enzyme inhibitor, blocking the activity of protein tyrosine kinases and preventing threonine phosphorylation. By inhibiting reversible phosphorylation, the Src antibody effectively regulates cellular signaling pathways and gene expression.</p>

<p>Purified recombinant S100A8 protein</p>

<p>Purified Rabbit polyclonal eEF1 alpha antibody</p>

<p>Recombinant human PSMA6 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD47 antibody, catalog no. 70R-4426</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CAPN1 antibody, catalog no. 70R-10204</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZMYND11 antibody, catalog no. 20R-1094</p>

<p>Rabbit Polyclonal MEK1 antibody (Thr291)</p>

<p>Affinity purified Rabbit polyclonal SNX12 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PI15 antibody, catalog no. 70R-10223</p>

<p>Mouse monoclonal PIIANP antibody</p>

<p>Rabbit polyclonal Guinea Pig Serum Albumin antibody (HRP)</p>

<p>The Chlorpyrifos Antibody is a powerful inhibitory factor that targets antiphospholipid antibodies. This monoclonal antibody has neutralizing properties and is widely used in Life Sciences research. It specifically binds to GM-CSF (granulocyte-macrophage colony-stimulating factor), chemokines, interferons, and E-cadherin. The Chlorpyrifos Antibody can effectively induce lysis of cells expressing these markers and has been extensively tested for its efficacy. It contains excipients to ensure stability and potency. Additionally, this antibody has shown promising results in targeting alpha-fetoprotein, making it a valuable tool in the development of diagnostic and therapeutic applications.</p>

<p>Rabbit polyclonal DCLK2 antibody</p>

<p>1-175 amino acids: MSSQIRQNYS TDVEAAVNSL VNLYLQASYT YLSLGFYFDR DDVALEGVSH FFRELAEEKR EGYERLLKMQ NQRGGRALFQ DIKKPAEDEW GKTPDAMKAA MALEKKLNQA LLDLHALGSA RTDPHLCDFL ETHFLDEEVK LIKKMGDHLT NLHRLGGPEA GLGEYLFERL TLKHD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHAD antibody, catalog no. 70R-5470</p>

<p>St6galnac1 antibody was raised in rabbit using the C terminal of St6galnac1 as the immunogen</p>

<p>The NELL1 antibody is a highly specialized monoclonal antibody that targets the growth factor-1 receptor. It has been extensively studied and shown to have a significant impact on various cellular processes. This antibody specifically binds to the nuclear region of cells, where it modulates the activity of chemokines and other signaling molecules involved in cell growth and differentiation.</p>

<p>Rabbit polyclonal 5HT1E antibody</p>

<p>Mouse monoclonal Hepatitis C Virus antibody (core)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYNJ1 antibody, catalog no. 70R-4810</p>

<p>IKBKB antibody was raised in Mouse using a purified recombinant fragment of IKBKB expressed in E. coli as the immunogen.</p>

<p>Myoglobin antibody was raised in goat using Human Myoglobin (cardiac) as the immunogen.</p>

<p>Rabbit polyclonal RPL38 antibody (HRP)</p>

<p>The UCHL1 antibody is a highly versatile and potent tool in the field of immunology. It has been extensively studied for its ability to interfere with various biological processes, making it an essential component in research and clinical applications.</p>

<p>Rabbit polyclonal PRKAA2 antibody</p>

<p>The IRS1 antibody is a glycopeptide that specifically targets and binds to the insulin receptor substrate 1 (IRS1). This monoclonal antibody has been developed to detect autoantibodies against IRS1, which are associated with autoimmune disorders such as type 1 diabetes. The IRS1 antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA. It has high specificity and sensitivity for detecting IRS1 in different samples, including tissues, cells, and body fluids. This antibody can also be conjugated to different markers or enzymes for visualization purposes. The IRS1 antibody is a valuable tool for researchers studying insulin signaling pathways, autoimmune diseases, and related fields.</p>

<p>The MYD88 antibody is a highly effective inhibitor that targets the apical membrane of cells. It specifically binds to collagen and prevents its interaction with other molecules, thereby inhibiting various cellular processes. This antibody has been extensively used in research and clinical settings to study the role of MYD88 in different biological pathways. MYD88 antibodies have also shown promising results in inhibiting hepatocyte growth factor and epidermal growth factor signaling, which are crucial for cell proliferation and survival. Additionally, these antibodies have been used as diagnostic tools in human folate receptor studies and as therapeutic agents against certain types of cancer. With their high specificity and potency, MYD88 antibodies are valuable tools in life sciences research and hold great potential for future applications.</p>

<p>Affinity purified Rabbit polyclonal PHLP antibody</p>

<p>CD72 antibody was raised in Rabbit using Human CD72 as the immunogen</p>

<p>LCN1 antibody was raised in rabbit using the C terminal of LCN1 as the immunogen</p>

<p>Purified Rabbit polyclonal PUB73 antibody</p>

<p>The Vimentin antibody is a highly specific monoclonal antibody that targets the protein vimentin. Vimentin is an intermediate filament protein that plays a crucial role in maintaining the structural integrity of cells. This antibody has been widely used in various research fields, including Life Sciences and histidine studies.</p>

<p>ACCN5 antibody was raised using the middle region of ACCN5 corresponding to a region with amino acids FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NXPH3 antibody, catalog no. 70R-4470</p>

<p>Keratin K72 antibody was raised in Guinea Pig using synthetic peptide of human keratin K72 coupled to KLH as the immunogen.</p>

<p>ITGBL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKC</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ESD antibody, catalog no. 70R-3731</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CACNA1G antibody, catalog no. 70R-5150</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been proven through extensive research using advanced techniques like the patch-clamp technique on human erythrocytes. The metabolization process involves various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains, effectively inhibiting their growth in culture.</p>

<p>Ctp Synthase antibody was raised using the N terminal of CTPS corresponding to a region with amino acids  SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HEPH antibody, catalog no. 70R-7345</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZBTB3 antibody, catalog no. 70R-8377</p>

<p>GNAS antibody was raised using the C terminal of GNAS corresponding to a region with amino acids YFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY</p>

<p>Osteopontin protein is a versatile binding protein commonly used in Life Sciences research. It plays a crucial role in various biological processes, including cell adhesion, migration, and tissue remodeling. Osteopontin can be detected through hybridization techniques and is often used as a marker for specific cellular events.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CD4 antibody, catalog no. 70R-9673</p>

<p>HARS antibody was raised in rabbit using the N terminal of HARS as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Cytokeratin 31 antibody</p>

<p>OAZ2 antibody was raised using the middle region of OAZ2 corresponding to a region with amino acids PDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFL</p>

<p>SEYDYVSFQS DIGPYQSGRF YTKPPQCVDI PADLRLCHNV GYKKMVLPNL LEHETMAEVK QQASSWVPLL NKNCHAGTQV FLCSLFAPVC LDRPIYPCRW LCEAVRDSCE PVMQFFGFYW PEMLKCDKFP EGDVCIAMTP PNATEASKPQ GTTVCPPCDN ELKSEAIIEH LCASEFALRM KIKEVKKENG DKKIVPKKKK PLKLGPIKKK DLKKLVLYLK NGADCPCHQL DNLSHHFLIM GRKVKSQYLL TAIHKWDKKN KEFKNFMKKM KNHECPTFQS VFK</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TCP11 antibody, catalog no. 70R-3950</p>

<p>UBE2I antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRA</p>

<p>Rabbit polyclonal OBFC2B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TPST2 antibody, catalog no. 70R-6948</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSMA1 antibody, catalog no. 70R-1371</p>

<p>Rabbit polyclonal Ezrin antibody (Tyr353)</p>

<p>The SYK antibody is a powerful medicament that plays a crucial role in various biological processes. This polyclonal antibody specifically targets the surface glycoprotein SYK, which is involved in signal transduction pathways. By binding to this glycoprotein, the SYK antibody effectively inhibits its function and modulates downstream cellular responses.</p>

<p>Rabbit polyclonal CHD4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TPTE antibody, catalog no. 70R-5655</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MGC87631 antibody, catalog no. 70R-4558</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAPKAPK3 antibody, catalog no. 70R-10036</p>

<p>Mitofusin 1 antibody was raised using the middle region of MFN1 corresponding to a region with amino acids QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ</p>

<p>The Vitamin D antibody is an essential tool for immunoassays in the field of Life Sciences. This antibody is specifically designed to bind to Vitamin D and its metabolites, allowing for accurate detection and measurement in various assays. The antibody is highly specific and can be used in a variety of applications, including ELISA, Western blotting, and immunohistochemistry.</p>

<p>Rabbit polyclonal FKHRL1 antibody (Ser253)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MLC1 antibody, catalog no. 70R-5137</p>

<p>PLEKHB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRE</p>

<p>STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEEN</p>

<p>NHEJ1 antibody was raised in Rabbit using Human NHEJ1 as the immunogen</p>

<p>Rabbit anti-mouse lambda chain (biotin) was raised in rabbit using murine lambda light chain as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC10A4 antibody, catalog no. 70R-6295</p>

<p>The cRAF antibody is a polyclonal antibody used in Life Sciences research. It specifically targets the cRAF protein, a tyrosine kinase receptor involved in various cellular processes such as endothelial growth and collagen synthesis. This antibody can be used to study the role of cRAF in signal transduction pathways and its interaction with other proteins and growth factors. Additionally, the cRAF antibody has been shown to have potential therapeutic applications, including the treatment of autoimmune disorders and certain types of cancer. Its high specificity and affinity make it a valuable tool for researchers studying protein-protein interactions and signaling pathways involving cRAF.</p>

<p>Rabbit polyclonal VIPR2 antibody</p>

<p>VDAC2 antibody was raised using the N terminal of VDAC2 corresponding to a region with amino acids VKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWN</p>

<p>ZNF91 antibody was raised in rabbit using the N terminal of ZNF91 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IMP3 antibody, catalog no. 70R-4709</p>

<p>Purified recombinant Human UBE2F Protein (His tag)</p>

<p>Region of MIP5 protein corresponding to amino acids QFTNDAETEL MMSKLPLENP VVLNSFHFAA DCCTSYISQS IPCSLMKSYF ETSSECSKPG VIFLTKKGRQ VCAKPSGPGV QDCMKKLKPY SI.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUP98 antibody, catalog no. 70R-5608</p>

<p>HADH antibody was raised in rabbit using the middle region of HADH as the immunogen</p>

<p>The SET antibody is a polyclonal antibody that is commonly used in the field of Life Sciences. It is specifically designed to target and bind to the SET protein, which plays a crucial role in various cellular processes. The SET antibody has been extensively tested and validated for its high specificity and sensitivity in detecting the presence of SET protein.</p>

<p>Affinity purified Rabbit polyclonal OPCml antibody</p>

<p>Purified recombinant Human NUDT10 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AK2 antibody, catalog no. 70R-3439</p>

<p>Rabbit polyclonal IKappaB beta antibody (Thr19)</p>

<p>Rabbit polyclonal ARHGEF18 antibody (biotin)</p>

<p>SMYD4 antibody was raised in rabbit using the N terminal of SMYD4 as the immunogen</p>

<p>The Keratin 10 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is a protein-coupled receptor that binds to glutamate and acts as a heparin cofactor. This antibody is commonly used in Life Sciences research, particularly in the study of fetal hemoglobin and its regulation. Additionally, it has been extensively utilized in the field of medicine for the development of targeted therapies and diagnostic tools.</p>

<p>FABP5 antibody was raised in Rabbit using Human FABP5 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATP7A antibody, catalog no. 70R-6678</p>

<p>ALPK1 antibody was raised in Rabbit using Human ALPK1 as the immunogen</p>

<p>Rabbit polyclonal CREB antibody (Ser133)</p>

<p>Purified Rabbit polyclonal MADS14 antibody</p>

<p>Rabbit polyclonal JAK2 antibody (Tyr1007)</p>

<p>Rabbit anti-chicken IgG (H+L) (FITC) was raised in rabbit using chicken IgG whole molecule as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal SLC6A4 antibody</p>

<p>LYZ antibody was raised in rabbit using the C terminal of LYZ as the immunogen</p>