Biochemicals and Reagents

<p>Rabbit polyclonal ZAP70 antibody (Tyr315)</p>

<p>This antibody reacts with heavy (gamma) chains on rat IgG and light chains on all rat immunoglobulins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAVER2 antibody, catalog no. 70R-4637</p>

<p>C21ORF13 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSEEPLQSKESHPLPPSQASTSHAFGDSKVTVVNSIKPSSPTEGKRKIII</p>

<p>Purified recombinant HS3ST1 protein (His tag)</p>

<p>Purified Polyclonal NGEP antibody</p>

<p>Mouse monoclonal RASSF1 antibody</p>

<p>CCDC25 antibody was raised using the middle region of CCDC25 corresponding to a region with amino acids DLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREMDELRSYSSLMKV</p>

<p>The Phytase antibody is a Monoclonal Antibody that is used in various applications in the Life Sciences field. It is produced by hybridoma cells and has been extensively studied for its antigen-antibody reaction properties. This antibody can be used in assays to detect and quantify phytase, an enzyme that plays a crucial role in the breakdown of phytic acid, a compound found in plants.</p>

<p>The Nestin antibody is a monoclonal antibody used in Life Sciences research. It specifically targets Nestin, a protein that is highly expressed in cells of the central nervous system during development and in certain types of tumors. This antibody has been shown to have a high affinity for Nestin and can be used for various applications, including immunohistochemistry and Western blotting. Additionally, studies have indicated that the Nestin antibody may have therapeutic potential in the treatment of certain diseases, such as cancer and neurodegenerative disorders. Its ability to inhibit tumor growth and induce apoptosis makes it a promising candidate for further research and development.</p>

<p>The TRPC6 antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of Polyclonal Antibodies and has various applications in research and diagnostics. This antibody specifically targets TRPC6, which is a fatty acid-activated cation channel involved in numerous physiological processes.</p>

<p>Mouse monoclonal KCNJ3 antibody</p>

<p>PRKAB1 antibody was raised using the N terminal of PRKAB1 corresponding to a region with amino acids KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW</p>

<p>NDUFS3 antibody was raised using the middle region of NDUFS3 corresponding to a region with amino acids EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK</p>

<p>The metabolite of furazolidone-OVA</p>

<p>Mouse monoclonal GRIA3 antibody</p>

<p>Purified recombinant NBL1 protein (His tag)</p>

<p>ZNF286 antibody was raised in rabbit using the N terminal of ZNF286 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, thus preventing transcription and replication. Its efficacy has been confirmed through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Mouse RBC antibody (FITC) was raised in rabbit using mouse erythrocytes as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its efficacy has been demonstrated through extensive research using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. The metabolism of this drug involves various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>SLC37A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLDAKKAGELSTLFD</p>

<p>Rabbit polyclonal BCAS2 antibody</p>

<p>PTK7 antibody was raised in Mouse using a purified recombinant fragment of human PTK7 expressed in E. coli as the immunogen.</p>

<p>The ARNT antibody is a valuable tool in the field of Life Sciences. It is widely used for transfer reactions and immunoassays. This antibody specifically targets anti-VEGF (Vascular Endothelial Growth Factor) and is available in both polyclonal and monoclonal forms. The ARNT antibody can be utilized for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>Mouse monoclonal HBV Pres 1 antibody</p>

<p>Rabbit polyclonal VATPase G1 antibody (HRP)</p>

<p>SNX7 antibody was raised using the middle region of SNX7 corresponding to a region with amino acids LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND</p>

<p>KHSRP antibody was raised using the middle region of KHSRP corresponding to a region with amino acids WEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGG</p>

<p>Rabbit polyclonal OR13H1 antibody</p>

<p>Rabbit polyclonal RAB18 antibody</p>

<p>Rabbit polyclonal SELE antibody</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside:<br>Experience the power of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside, the ultimate antituberculosis drug from the rifamycin class. This potent compound is specifically designed to combat tuberculosis infections with its strong bactericidal activity. By binding to DNA-dependent RNA polymerase, it effectively inhibits bacterial growth, preventing transcription and replication. Tested on human erythrocytes using a patch-clamp technique, this active form has shown remarkable effectiveness. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it offers a comprehensive solution against Mycobacterium tuberculosis strains. Don't let tuberculosis hold you back - choose 6-Fluoro-3-indox</p>

<p>C5ORF4 antibody was raised using the N terminal Of C5Orf4 corresponding to a region with amino acids MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ</p>

<p>The E2F-1 antibody is a highly specific monoclonal antibody that targets the E2F-1 protein. This protein plays a crucial role in cell cycle regulation and is involved in various biological processes, such as cell proliferation, differentiation, and apoptosis. The E2F-1 antibody has been extensively used in research studies to investigate the function of E2F-1 and its interaction with other molecules.</p>

<p>ZDHHC14 antibody was raised using the N terminal of ZDHHC14 corresponding to a region with amino acids TLLRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVII</p>

<p>C13ORF28 antibody was raised using the middle region of C13Orf28 corresponding to a region with amino acids PGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQ</p>

<p>KCNMA1 antibody was raised using the middle region of KCNMA1 corresponding to a region with amino acids ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITD</p>

<p>ZADH1 antibody was raised using the middle region of Zadh1 corresponding to a region with amino acids ILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKT</p>

<p>The OSR1 antibody is a highly specialized antibody that targets and neutralizes the protease activity of OSR1. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications in the Life Sciences field. The OSR1 antibody can be used for various research purposes, including the study of interleukin-6 and glucagon signaling pathways. It can also be used in immunoassays and other experimental techniques that require the immobilization of OSR1 or related proteins. With its high specificity and effectiveness, the OSR1 antibody is an essential tool for researchers working in the fields of molecular biology, biochemistry, and immunology.</p>

<p>KRT4 antibody was raised in Rabbit using Human KRT4 as the immunogen</p>

<p>The HDAC6 antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to target and inhibit the activity of histone deacetylase 6 (HDAC6). This antibody has been shown to effectively block the growth factor signaling pathways that are regulated by HDAC6, making it a valuable tool for studying the role of HDAC6 in various cellular processes.</p>

<p>GNB2L1 antibody was raised in Rabbit using Human GNB2L1 as the immunogen</p>

<p>Purified recombinant LAMTOR2 protein (His tag)</p>

<p>LMOD1 antibody was raised in Rabbit using Human LMOD1 as the immunogen</p>

<p>Recombinant Human CTGF protein (His tag)</p>

<p>Mouse monoclonal LSM1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IL4 antibody, catalog no. 70R-6231</p>

<p>INSC antibody was raised in Rabbit using Human INSC as the immunogen</p>

<p>Mouse monoclonal PPP3CA antibody</p>

<p>Cytokeratin 18 antibody (FITC) was raised in mouse using human cytokeratin 18 from HeLa cytoskeletal preparation as the immunogen.</p>

<p>KC antibody was raised in rabbit using highly pure recombinant murine KC as the immunogen.</p>

<p>Phosphotyrosine antibody was raised in rabbit using Iodoacetylphosphotyrosine-KLH conjugate as the immunogen.</p>

<p>DPYSL2 antibody was raised using the middle region of DPYSL2 corresponding to a region with amino acids NIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKR</p>

<p>MICA antibody was raised using the N terminal of MICA corresponding to a region with amino acids LHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQ</p>

<p>The MARK antibody is a monoclonal antibody that specifically targets and binds to the activated form of fatty acid. It is designed to recognize and interact with a specific antigen, such as interleukins or IFN-gamma, which are involved in various biological processes including cell growth and immune response. This antibody can be used in life sciences research to study the role of these molecules in different pathways and diseases. Additionally, the MARK antibody can also be utilized as an inhibitor by blocking the interaction between the targeted molecule and its receptors, thus modulating specific cellular functions. With its high specificity and affinity, this antibody is a valuable tool for researchers in their quest to understand complex biological mechanisms.</p>

<p>Purified Polyclonal TPL2 antibody</p>

<p>Rat thrombocyte antibody was raised in rabbit using mouse thrombocytes as the immunogen.</p>

<p>Mouse monoclonal NSMCE2 antibody</p>

<p>Purified Polyclonal Adenosine Kinase antibody</p>

<p>RBMXL2 antibody was raised using the middle region of RBMXL2 corresponding to a region with amino acids SSRDGYSSRDYREPRGFAPSPGEYTHRDYGHSSVRDDCPLRGYSDRDGYG</p>

<p>ZNF326 antibody was raised in rabbit using the N terminal of ZNF326 as the immunogen</p>

<p>The ANTXR1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It targets the ANTXR1 protein, which plays a crucial role in collagen metabolism and liver microsome function. This antibody can be utilized in various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). It has been proven to be effective in identifying and quantifying ANTXR1 expression levels in different cell types and tissues.</p>

<p>Rabbit polyclonal CDC25A antibody (Thr507)</p>

<p>MPZL1 antibody was raised using the middle region of MPZL1 corresponding to a region with amino acids ISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVE</p>

<p>FGF21 protein is a growth factor that plays a crucial role in various biological processes. It acts as a chemokine and has anti-VEGF (vascular endothelial growth factor) properties, making it an important molecule for regulating endothelial growth. FGF21 protein is widely used in the field of Life Sciences, particularly in research related to adipose tissue and metabolic disorders.</p>

<p>UFD1L antibody was raised in rabbit using the middle region of UFD1L as the immunogen</p>

<p>MAP4K5 antibody was raised using the middle region of MAP4K5 corresponding to a region with amino acids QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA</p>

<p>Purified Polyclonal IKK beta antibody</p>

<p>Mouse monoclonal SPTAN1 antibody</p>

<p>Mouse monoclonal MAB21L3 antibody</p>

<p>Rat monoclonal Integrin beta 7 antibody (biotin)</p>

<p>The QSOX1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that can neutralize the activity of QSOX1, an enzyme involved in the formation of disulfide bonds in proteins. This antibody recognizes a conformational epitope on QSOX1 and inhibits its function as a topoisomerase inhibitor.</p>

<p>TNKS1BP1 antibody was raised using the middle region of TNKS1BP1 corresponding to a region with amino acids DGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFIE</p>

<p>Rabbit polyclonal VATPase G1 antibody (FITC)</p>

<p>MBD5 antibody was raised in Rabbit using Human MBD5 as the immunogen</p>

<p>Mouse monoclonal HSD17B10 antibody</p>

<p>Mouse monoclonal BUB1B antibody</p>

<p>The CYP2J2 antibody is a highly specialized monoclonal antibody that targets β-catenin, a key protein involved in cell adhesion and signaling pathways. This antibody specifically inhibits the activation of chemokine receptors, which are important for immune cell recruitment and inflammation. It has been extensively studied as a potential therapeutic target for various diseases, including cancer and cardiovascular disorders.</p>

<p>Cefmetazole (USP grade powder) chemical reference substance</p>

<p>Cited4 antibody was raised in rabbit using the middle region of Cited4 as the immunogen</p>

<p>Purified recombinant KCNMB3 protein (His tag)</p>

<p>Purified recombinant SULT1C4 protein (His tag)</p>

<p>RNP protein is a recombinant protein produced in E. coli, which is used as a marker for mixed connective tissue disease (MCTD). It is a component of U1-RNP, a ribonucleoprotein complex that contains the antigen recognized by anti-U1-ribonucleoprotein antibody. RNP protein can be used to detect and quantify MCTD in serum samples. This purified recombinant protein is suitable for use in Life Sciences research, Proteins and Antigens applications.</p>

<p>Mouse monoclonal TFDP1 antibody</p>

<p>1-(2-Phenylpropan-2-yl)piperidine hydrochloride is a chemical compound categorized as a piperidine derivative. Piperidines are a class of organic compounds based on a six-membered ring containing five carbon atoms and one nitrogen atom. This particular compound is synthesized through a series of chemical reactions involving its precursor piperidine, and then combined with hydrochloric acid to form its hydrochloride salt, which increases its solubility and stability.</p>

<p>Purified Polyclonal NF kappaB p105/p50 antibody</p>

<p>Purified native Human CA 72-4 protein</p>

<p>ABAT antibody was raised using the middle region of ABAT corresponding to a region with amino acids YRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATT</p>

<p>Recombinant human TNF-α</p>

<p>The CD11a antibody is a monoclonal antibody that specifically targets the CD11a protein. CD11a is an activated growth factor that plays a crucial role in various biological processes. This antibody has been extensively studied and has shown high affinity and specificity for CD11a.</p>

<p>GPR120 modulator 1 is a peptide that belongs to the class of protein interactions. It is an inhibitor that functions by binding to the receptor for G-protein coupled receptors 120 (GPR120) and blocking its activation. This product can be used as a research tool or as an antibody. GPR120 modulator 1 has been shown to inhibit ion channels and activate GPR120.</p>

<p>Mouse monoclonal PACSIN3 antibody</p>

<p>The RPE65 antibody is a monoclonal antibody that has been extensively used in Life Sciences research. It specifically targets the RPE65 protein, which plays a crucial role in the visual cycle and is involved in the regeneration of visual pigments. The RPE65 antibody has been proven to be highly specific and sensitive in detecting RPE65 expression in various tissues and cell types.</p>

<p>IL17F antibody was raised in rabbit using highly pure recombinant human IL-17F as the immunogen.</p>

<p>The EIF4E antibody is a highly specialized monoclonal antibody that targets the eukaryotic translation initiation factor 4E (EIF4E). This glycoprotein plays a crucial role in the regulation of protein synthesis and is involved in various cellular processes. The antibody specifically recognizes and binds to EIF4E dimers, inhibiting its activity and preventing the initiation of translation.</p>

<p>This antibody reacts with heavy chains on Goat IgG and light chains on all Goat immunoglobulins.</p>

<p>The Cry1Ab antibody is a cytotoxic monoclonal antibody that targets the tyrosine kinase activity of the glucose transporter. It has been extensively studied in Life Sciences and has shown promising results in various applications. The Cry1Ab antibody specifically binds to activated protein kinases and inhibits their function, leading to a decrease in cell proliferation and survival. Additionally, this antibody has been shown to inhibit collagen synthesis, making it a potential therapeutic option for diseases characterized by excessive collagen production. Furthermore, the Cry1Ab antibody has also demonstrated efficacy as an anti-CD20 antibody in preclinical studies, suggesting its potential use in treating B-cell malignancies. In vitro experiments have shown that this antibody effectively neutralizes its target and exhibits minimal cross-reactivity with other proteins present in human serum. With its unique mechanism of action and promising preclinical data, the Cry1Ab antibody holds great potential for future therapeutic development.</p>

<p>Purified Rabbit polyclonal GRAP antibody</p>

<p>This antibody reacts with heavy chains on human IgE (epsilon chain).</p>