Biochemicals and Reagents

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNC3 antibody, catalog no. 70R-5136</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACVR1C antibody, catalog no. 70R-7481</p>

<p>Purified recombinant Human MAPRE3 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of XYLT1 antibody, catalog no. 70R-8826</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SCFD1 antibody, catalog no. 70R-3833</p>

<p>Pan-retinoic acid receptor (RAR) antagonist</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GALK1 antibody, catalog no. 70R-10394</p>

<p>The Beta catenin antibody is a protein that plays a crucial role in various biological processes, including cell adhesion and signaling. It interacts with other proteins such as fibronectin, alpha-fetoprotein, and interferon to regulate cell growth and development. This antibody is widely used in Life Sciences research to study the function of β-catenin and its involvement in different cellular pathways.</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>Purified recombinant HLA-DRA protein (His tag)</p>

<p>C11orf16 antibody was raised in rabbit using the middle region of C11orf16 as the immunogen</p>

<p>The BAG4 antibody is a highly specialized antibody used in the field of Life Sciences. It is a polyclonal antibody that has been extensively studied and proven to be effective in various research applications. This antibody specifically targets BAG family molecular chaperone regulator 4 (BAG4), which plays a crucial role in cell signaling and regulation.</p>

<p>Ethyl Glucuronide-BSA Hapten Conjugate</p>

<p>MAP4K3 antibody was raised in Rabbit using Human MAP4K3 as the immunogen</p>

<p>Thyroglobulin protein is a vital component in the field of Life Sciences. It is a native protein that plays a crucial role in various biological processes. This protein acts as a growth factor and is involved in the regulation of hepcidin, interleukin-6, dopamine, and droperidol. Additionally, it has been studied for its enzyme genotype and its interaction with haloperidol. Thyroglobulin protein is also known to possess neutralizing properties against certain substances.</p>

<p>Rabbit polyclonal TOR2A antibody</p>

<p>The Ku80 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the Ku80 protein, which plays a crucial role in DNA repair and maintenance. This antibody is commonly used in studies involving interferon signaling, as well as the detection and analysis of various antibodies.</p>

<p>COX15 antibody was raised in Rabbit using Human COX15 as the immunogen</p>

<p>This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.</p>

<p>IL17 antibody was raised in rabbit using highly pure recombinant hIL-17A as the immunogen.</p>

<p>LZIC antibody was raised in Rabbit using Human LZIC as the immunogen</p>

<p>Transportin 1/MIP Monoclonal Antibody</p>

<p>Rabbit polyclonal MRPL41 antibody</p>

<p>CD64 antibody (Fab'2) was raised in mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.</p>

<p>Goat anti-rat IgG (H+L) (biotin) was raised in goat using rat IgG, whole molecule as the immunogen.</p>

<p>NCK2 antibody was raised in Rabbit using Human NCK2 as the immunogen</p>

<p>Rabbit polyclonal Calreticulin antibody (HRP)</p>

<p>Rat monoclonal CD132 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACCN1 antibody, catalog no. 70R-5101</p>

<p>BMPR1A antibody was raised in Rabbit using Human BMPR1A as the immunogen</p>

<p>KI67 antibody was raised in Mouse using a purified recombinant fragment of KI167(aa3118-3256) expressed in E. coli as the immunogen.</p>

<p>RGS10 antibody was raised using the middle region of RGS10 corresponding to a region with amino acids DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CSTF3 antibody, catalog no. 70R-4882</p>

<p>The p53 protein is a vital component in the field of Life Sciences. It plays a crucial role in regulating cell growth and preventing tumor formation. This protein is activated in response to DNA damage and acts as a transcription factor, controlling the expression of genes involved in cell cycle arrest, DNA repair, and apoptosis.</p>

<p>Rabbit polyclonal MAPKAPK2 antibody</p>

<p>Purified Dog IgG (Fab'2) FITC conjugate</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RIT1 antibody, catalog no. 70R-10367</p>

<p>RPUSD2 antibody was raised using the C terminal of RPUSD2 corresponding to a region with amino acids AEHQAKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEE</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LIPT1 antibody, catalog no. 70R-2759</p>

<p>Rabbit polyclonal TPMT antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of hCG_2042202 antibody, catalog no. 70R-9063</p>

<p>Rabbit polyclonal OR5H15 antibody</p>

<p>MYH1 antibody was raised using the N terminal of MYH1 corresponding to a region with amino acids KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK</p>

<p>Influenza B antibody (HRP) was raised in goat using yamagata strain of Influenza B as the immunogen.</p>

<p>The SHC1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize specific virus surface antigens, making it an essential tool for researchers studying viral infections. Additionally, this antibody has been found to have potential therapeutic applications in the development of DNA vaccines.</p>

<p>Rabbit polyclonal TEAD1 antibody</p>

<p>The Cytochrome C antibody is a monoclonal antibody that specifically binds to cytochrome C, a human protein involved in various cellular processes. This antibody is commonly used in Life Sciences research and diagnostic applications. It can be used for receptor binding studies, hybridization assays, and cellular assays to detect the presence of cytochrome C in various samples such as human serum or tissue lysates. The Cytochrome C antibody is highly specific and has high affinity towards its target, making it a valuable tool for scientists studying cytochrome C function and its role in disease development. Whether you're conducting basic research or developing new diagnostic tools, this monoclonal antibody is an essential component in your toolkit.</p>

<p>EIF1AX antibody was raised in Rabbit using Human EIF1AX as the immunogen</p>

<p>Rabbit polyclonal GJB7 antibody</p>

<p>ALOX15B antibody was raised in Rabbit using Human ALOX15B as the immunogen</p>

<p>Rabbit polyclonal Cullin 3 antibody</p>

<p>Purified recombinant Human DIMT1 protein (His tag)</p>

<p>The PROS1 antibody is a highly effective medicament that belongs to the class of antibodies. It has been extensively studied for its therapeutic potential in various medical conditions. This antibody specifically targets and binds to PROS1, a protein involved in regulating blood coagulation and cell growth.</p>

<p>The FASL antibody is a powerful tool in the field of Life Sciences. It is an amino group-containing antibody that specifically targets the HER2 protein, which is known to be involved in various cellular processes. One of the key functions of the FASL antibody is its ability to induce apoptosis through the FAS-mediated pathway. This means that it can trigger programmed cell death in cells that express high levels of HER2, making it a valuable tool for researchers studying cancer and other diseases.</p>

<p>Rabbit anti-mouse lambda chain (Alk Phos) was raised in rabbit using murine lambda light chain as the immunogen.</p>

<p>Rabbit polyclonal ATRIP antibody</p>

<p>VIPAR antibody was raised using the middle region of VIPAR corresponding to a region with amino acids VEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKI</p>

<p>Tdp1 antibody was raised in rabbit using the middle region of Tdp1 as the immunogen</p>

<p>C22ORF9 antibody was raised using the middle region of C22Orf9 corresponding to a region with amino acids ERVTSFSTPPTPERNNRPAFFSPSLKRKVPRNRIAEMKKSHSANDSEEFF</p>

<p>Mouse monoclonal NEUROG1 antibody</p>

<p>Rabbit polyclonal SSR1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UPF1 antibody, catalog no. 70R-4618</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BCO2 antibody, catalog no. 70R-10117</p>

<p>Purified Polyclonal Carbonic Anhydrase 6 antibody</p>

<p>Rabbit polyclonal AGPAT5 antibody</p>

<p>Rabbit polyclonal SHP1 antibody (Tyr564)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WNT16 antibody, catalog no. 70R-2001</p>

<p>TRIM23 antibody was raised in rabbit using the C terminal of TRIM23 as the immunogen</p>

<p>Purified Polyclonal CD184 antibody</p>

<p>BRPF3 antibody was raised in rabbit using the N terminal of BRPF3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MRTO4 antibody, catalog no. 70R-2933</p>

<p>Cytokeratin 18 antibody was raised using the C terminal of KRT18 corresponding to a region with amino acids ALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRAPPC5 antibody, catalog no. 70R-3203</p>

<p>Rabbit polyclonal Spermidine synthase antibody (biotin)</p>

<p>Rabbit polyclonal PFDN5 antibody (HRP)</p>

<p>DAP antibody was raised in Rabbit using Human DAP as the immunogen</p>

<p>Rabbit Polyclonal Estrogen Receptor alpha antibody (Tyr537)</p>

<p>HSPD1 antibody was raised in rabbit using the C terminal of HSPD1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DGCR6L antibody, catalog no. 70R-10201</p>

<p>ARL17 antibody was raised using the middle region of ARL17 corresponding to a region with amino acids KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD</p>

<p>Mouse monoclonal PUS7 antibody</p>

<p>PPP1R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRVHAALVYHKHLKRVF</p>

<p>Rabbit anti-human IgA (Alk Phos) was raised in rabbit using human IgA heavy chain as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIRT4 antibody, catalog no. 70R-7924</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAD2L1BP antibody, catalog no. 70R-10299</p>

<p>The Rb antibody is a monoclonal antibody that targets the growth factor receptor trastuzumab. It belongs to the class of antibodies known as chemokines, which are involved in immune responses. This antibody specifically binds to the epidermal growth factor receptor (EGFR) and inhibits its activity. In addition to its role in cancer therapy, this antibody has also been used in life sciences research for its ability to neutralize cytotoxic effects of certain proteins, such as anti-acth antibodies and TGF-beta. The Rb antibody has shown efficacy against various pathogens, including Mycoplasma genitalium.</p>

<p>The PMVK antibody is a highly specialized monoclonal antibody that acts as a family kinase inhibitor. It is colloidal in nature and has been extensively studied for its potential to inhibit endothelial growth. This antibody specifically targets the alpha-fetoprotein, which plays a crucial role in tumor development and progression.</p>

<p>The IL8 antibody is a highly effective neutralizing antibody that specifically targets and binds to Interleukin-8 (IL-8), a chemokine involved in inflammation and immune response. This monoclonal antibody has been extensively studied and proven to be highly specific and potent in its ability to block the activity of IL-8.</p>

<p>DIP2A antibody was raised using a synthetic peptide corresponding to a region with amino acids PLKEFFVDDFEELLEVQQPDPNQPKPEGSETSVLRGEPLTAGVPRPPSLL</p>

<p>The HER3 antibody is a highly specialized and effective tool for targeted therapy. It consists of both polyclonal and monoclonal antibodies that specifically bind to the HER3 protein, which is a key component of various protein complexes involved in cellular signaling pathways. By binding to the HER3 protein, these antibodies neutralize its activity and prevent it from being activated.</p>

<p>HSDL1 antibody was raised in rabbit using the N terminal of HSDL1 as the immunogen</p>

<p>Rabbit polyclonal RhoA antibody (HRP)</p>

<p>The UBE2G2 protein is a conjugated protein that plays a crucial role in various biological processes. It is involved in the regulation of angptl3, interferon, and other important molecules in human serum. The UBE2G2 protein can be detected and studied using monoclonal antibodies through techniques such as hybridization. This protein has been extensively used in life sciences research, particularly in studies related to cefmetazole, cefotiam, sodium carbonate, and anhydrous sodium. Streptavidin-activated monoclonal antibodies can be used to specifically bind and detect the UBE2G2 protein. With its wide range of applications, the UBE2G2 protein is a valuable tool for researchers studying proteins and antigens.</p>

<p>Purified Rabbit polyclonal OR51F1 antibody</p>

<p>17a-19-Nortestosterone 3 Conjugate for use in immunoassays</p>

<p>Goat anti-cat IgG (HRP) was raised in goat using feline IgG F(c) fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DHX15 antibody, catalog no. 70R-4689</p>

<p>Rabbit polyclonal RAD52 antibody (Tyr104)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HIBADH antibody, catalog no. 70R-2529</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GIPC1 antibody, catalog no. 70R-4857</p>