Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,117 products)
- By Biological Target(99,161 products)
- By Pharmacological Effects(6,787 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,710 products)
- Secondary Metabolites(14,222 products)
Found 130581 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-ITQSNAILR-OH
<p>Peptide H-ITQSNAILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NGGSPALNNNPR-OH
<p>Peptide H-NGGSPALNNNPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GVNDNEEGFFSAR-OH
<p>Peptide H-GVNDNEEGFFSAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVFVDLEPTVIDEVR-OH
<p>Peptide H-AVFVDLEPTVIDEVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Glycyl-L-phenylalanine
CAS:Formula:C11H14N2O3Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:222.24H-VVRFQEAANKQKQEL-OH
<p>Peptide H-VVRFQEAANKQKQEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YACNCVVGYIGER-OH
<p>Peptide H-YACNCVVGYIGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SELTQQLNALFQDK-OH
<p>Peptide H-SELTQQLNALFQDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HSQPWQVLVASR-OH
<p>Peptide H-HSQPWQVLVASR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EVQLVQSGAEVK-OH
<p>Peptide H-EVQLVQSGAEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PIKQLNGRTKTASGIRK-OH
<p>Peptide H-PIKQLNGRTKTASGIRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAVGVGKSA-OH
<p>Peptide H-GAVGVGKSA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLFVLGLFL-OH
<p>Peptide H-SLFVLGLFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DHIGTR-OH
<p>Peptide H-DHIGTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ACTGSTQHQCG-NH2
<p>Peptide ACTGSTQHQCG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C40H63N15O17S2Molecular weight:1,090.16 g/molH-CNNPMHQNC-OH
<p>Peptide H-CNNPMHQNC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVYNFATC-OH
<p>Peptide H-AVYNFATC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HPYFYAPELLFFAK-OH
<p>Peptide H-HPYFYAPELLFFAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLNSVSVPR-OH
<p>Peptide H-NLNSVSVPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DSQRKLQFYEDKHQLPAPKC-OH
<p>Peptide H-DSQRKLQFYEDKHQLPAPKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FQDGDLTLYQSNTILR-OH
<p>Peptide H-FQDGDLTLYQSNTILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VWSDVTPLTF-OH
<p>Peptide H-VWSDVTPLTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KVLEHVVRV-OH
<p>Peptide H-KVLEHVVRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FGGNPGGFGNQGGFGNSR-OH
<p>Peptide H-FGGNPGGFGNQGGFGNSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PSDRPFKQRRSFADC-OH
<p>Peptide H-PSDRPFKQRRSFADC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELVALLVR-OH
<p>Peptide H-ELVALLVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EQLGEFYEALDCLCIPR-OH
<p>Peptide H-EQLGEFYEALDCLCIPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FIRVVMYEGKK-OH
<p>Peptide H-FIRVVMYEGKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EAFSLFDK-OH
<p>Peptide H-EAFSLFDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSPAINVAMHVFR-OH
<p>Peptide H-GSPAINVAMHVFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ETLDPSAPK-OH
<p>Peptide H-ETLDPSAPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLHDDLLEA-OH
<p>Peptide H-VLHDDLLEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ESYN-OH
<p>Peptide H-ESYN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CHMRSAMSGLHLVKRR-OH
<p>Peptide H-CHMRSAMSGLHLVKRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLMWEAVTV-OH
<p>Peptide H-LLMWEAVTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLRPGGHFL-OH
<p>Peptide H-VLRPGGHFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VAGDSGFAAYSR-OH
<p>Peptide H-VAGDSGFAAYSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EFTPVLQADFQK-OH
<p>Peptide H-EFTPVLQADFQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FNWYVDDVEVHNAK-OH
<p>Peptide H-FNWYVDDVEVHNAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GEGTFTSDLSK-OH
<p>Peptide H-GEGTFTSDLSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NNALQNLARTISEAG-OH
<p>Peptide H-NNALQNLARTISEAG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NVTGFFQSLK-OH
<p>Peptide H-NVTGFFQSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IIDGVPVEITEK-OH
<p>Peptide H-IIDGVPVEITEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLGSGAFGTVYK-OH
<p>Peptide H-VLGSGAFGTVYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QSSGGDPEIVMHSFN-OH
<p>Peptide H-QSSGGDPEIVMHSFN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CAPPGYALL-OH
<p>Peptide H-CAPPGYALL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTVAGLAGK-OH
<p>Peptide H-VTVAGLAGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MMMMMMMMMMMM-OH
<p>Peptide H-MMMMMMMMMMMM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FRDYVDRFFKTLRAE-OH
<p>Peptide H-FRDYVDRFFKTLRAE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Amoxicillin VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody
<p>Amoxicillin VHH-8His-Cys-tag Recombinant Alpaca Monoclonal Antibody</p>H-FLGPLLVLQA-OH
<p>Peptide H-FLGPLLVLQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AKTDHGAEIVYKSPVVSGDTSPR-OH
<p>Peptide H-AKTDHGAEIVYKSPVVSGDTSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KYKNAVTEL-OH
<p>Peptide H-KYKNAVTEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLLMWITQA-OH
<p>Peptide H-SLLMWITQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLGAFSDGLAHLDNLK-OH
<p>Peptide H-VLGAFSDGLAHLDNLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLHTSATNLYLH-NH2
<p>Peptide H-GLHTSATNLYLH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KTTKQSFDL-OH
<p>Peptide H-KTTKQSFDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TTPPVLDSDGSFFLYSK^-OH
<p>Peptide H-TTPPVLDSDGSFFLYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SELEEQLTPVAEETR-OH
<p>Peptide H-SELEEQLTPVAEETR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSPLLRYAAWTGGLA-OH
<p>Peptide H-TSPLLRYAAWTGGLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPGSAAPYLK-OH
<p>Peptide H-DPGSAAPYLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NNFTVSFWLRVPKVSASHLEQ-OH
<p>Peptide H-NNFTVSFWLRVPKVSASHLEQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGEATDGARPQALPEPMQESK-OH
<p>Peptide H-SGEATDGARPQALPEPMQESK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YAWNRKRISNCVADY-OH
<p>Peptide H-YAWNRKRISNCVADY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLNEEIARV-OH
<p>Peptide H-GLNEEIARV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IAYKYAQL-OH
<p>Peptide H-IAYKYAQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KAVKLYRKLKRE-OH
<p>Peptide H-KAVKLYRKLKRE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGVPMSMRGGGK-OH
<p>Peptide H-GGVPMSMRGGGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VMPPRTLLL-OH
<p>Peptide H-VMPPRTLLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSELDDRADALQAGASQ-OH
<p>Peptide H-LSELDDRADALQAGASQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GVLTLNFQ-OH
<p>Peptide H-GVLTLNFQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DAPIYTNV-OH
<p>Peptide H-DAPIYTNV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PRGPDRPEGIEE-OH
<p>Peptide H-PRGPDRPEGIEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MFGGAKKR-OH
<p>Peptide H-MFGGAKKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLYDGREHSV-OH
<p>Peptide H-GLYDGREHSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GVVPHDFRI-OH
<p>H-GVVPHDFRI-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C48H74N14O12Molecular weight:1,039.2 g/molH-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH
<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-YTIWMPENPRPGTPCDIFTNSRGKRASNG-NH2
CAS:<p>Peptide H-YTIWMPENPRPGTPCDIFTNSRGKRASNG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTILDQSEAPVR-OH
<p>Peptide H-LTILDQSEAPVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NVIQISNDLENLR-OH
<p>Peptide H-NVIQISNDLENLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAIIGLMVGG-OH
<p>Peptide H-GAIIGLMVGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TELRTFSI-OH
<p>Peptide H-TELRTFSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLNELQALIEAHFENR-OH
<p>Peptide H-DLNELQALIEAHFENR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGEPLVLK-OH
<p>Peptide H-IGEPLVLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIIVFNLL-OH
<p>Peptide H-SIIVFNLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QSLDL-OH
<p>Peptide H-QSLDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EFTPQVQAAYQK-OH
<p>Peptide H-EFTPQVQAAYQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SHTLYTHITPDAVPQLPK-OH
<p>Peptide H-SHTLYTHITPDAVPQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSPGLLVSPGNLNK-OH
<p>Peptide H-NSPGLLVSPGNLNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TAAQNLYEK-OH
<p>Peptide H-TAAQNLYEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APAMFNIR-OH
<p>Peptide H-APAMFNIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EMRISRIILDFLFLRKK-OH
<p>Peptide H-EMRISRIILDFLFLRKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DWSSWVYRDPQT-OH
<p>Peptide H-DWSSWVYRDPQT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELVYETVR-OH
<p>Peptide H-ELVYETVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AKPALEDLR-OH
<p>Peptide H-AKPALEDLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSLANPGIA-OH
<p>Peptide H-NSLANPGIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-AIK-AMC
<p>Peptide Ac-AIK-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FDTLVGER-OH
<p>Peptide H-FDTLVGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KSIHIGPGRAFYATG-OH
<p>Peptide H-KSIHIGPGRAFYATG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPRGEVRFL-OH
<p>Peptide H-RPRGEVRFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QGFPWDILF-OH
<p>Peptide H-QGFPWDILF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GIVEQCCTSICSLYQ-OH
<p>Peptide H-GIVEQCCTSICSLYQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLVQPGGSL-OH
<p>Peptide H-GLVQPGGSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ADGSSWEGVGVVPDV-OH
<p>Peptide H-ADGSSWEGVGVVPDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAGSLQPLALEGSLQKR-OH
<p>Peptide H-GAGSLQPLALEGSLQKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGPSNTPPEI-OH
<p>Peptide H-SGPSNTPPEI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLVVVGAVGVGKSALTI-OH
<p>Peptide H-KLVVVGAVGVGKSALTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NQVSLTCLVK-OH
<p>Peptide H-NQVSLTCLVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VPFA-OH
<p>Peptide H-VPFA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLLLQYGSFCTQLNR-OH
<p>Peptide H-NLLLQYGSFCTQLNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIVLTQSPATLSLSP-OH
<p>H-EIVLTQSPATLSLSP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-QLSPFPFDL-OH
<p>Peptide H-QLSPFPFDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGTQFTR-OH
<p>Peptide H-VGTQFTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILHDGAYSL-OH
<p>Peptide H-ILHDGAYSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSQLQTYMI-OH
<p>Peptide H-LSQLQTYMI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTLTPEEEAR-OH
<p>Peptide H-VTLTPEEEAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LERFAVNPGLLETSE-OH
<p>Peptide H-LERFAVNPGLLETSE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GDTYPAELYITGSILR-OH
<p>Peptide H-GDTYPAELYITGSILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>λ Protein phosphatase
CAS:<p>Lambda Protein phosphatase can be used to release phosphate groups from phosphorylated serine, threonine and tyrosine residues in proteins. Different proteins are dephosphorylated at different rates.One unit is defined as the amount of enzyme that hydrolyses 1 nmol of p-Nitrophenyl Phosphate (EN13741) in 1 minute at 30°C in a total reaction volume of 50 µl.100 units of Lambda Protein phosphatase remove ~100% of phosphates (0.5 nmol) in phosphorylated myelin basic protein (phospho-MyBP, 18.5 kDa) in 30 minutes in a 50 µl reaction. The concentration of phospho-MyBP is 10 µM with respect to phosphate.</p>Purity:Min. 95%H-GFEPTLEALFGK-OH
<p>Peptide H-GFEPTLEALFGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YNSGK-OH
<p>Peptide H-YNSGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNIPTDVLK-OH
<p>Peptide H-LNIPTDVLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QEEEEDEDEER-OH
<p>Peptide H-QEEEEDEDEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALWALPHAA-OH
<p>Peptide H-ALWALPHAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Pan Plasmodium Aldolase Protein
<p>Please enquire for more information about Pan Plasmodium Aldolase Protein including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-ADQLADESLESTR-OH
<p>Peptide H-ADQLADESLESTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EVQLVESGGGLVQPGGSLR-OH
<p>Peptide H-EVQLVESGGGLVQPGGSLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRNNAQHLKVSGFSL-OH
<p>Peptide H-RRNNAQHLKVSGFSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLDEFMEGV-OH
<p>Peptide H-FLDEFMEGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGAGHVPEYFVGIGTPISFYG-OH
<p>Peptide H-GGAGHVPEYFVGIGTPISFYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HQGLPQEVLNENLLR-OH
<p>Peptide H-HQGLPQEVLNENLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NPVVHFFKNIVTPRT-OH
<p>Peptide H-NPVVHFFKNIVTPRT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KQRFHNIRGR-OH
<p>Peptide H-KQRFHNIRGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
<p>H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C194H295N55O57Molecular weight:4,309.81 g/molH-SITEVECFL-OH
<p>Peptide H-SITEVECFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KGAFDLSFF-OH
<p>Peptide H-KGAFDLSFF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AFYLAGGVPR-OH
<p>Peptide H-AFYLAGGVPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MNILLQYVVKSFD-OH
<p>Peptide H-MNILLQYVVKSFD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLFIIDGK-OH
<p>Peptide H-GLFIIDGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WTLTAPPGYR-OH
<p>Peptide H-WTLTAPPGYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSLYQLENY-OH
<p>Peptide H-CSLYQLENY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VALYVDWIR-OH
<p>Peptide H-VALYVDWIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MGTSSTDSQQAQHRRCSTSN-OH
<p>Peptide H-MGTSSTDSQQAQHRRCSTSN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GISSTTVTGR-OH
<p>Peptide H-GISSTTVTGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPPGFSPF-OH
<p>Peptide H-RPPGFSPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPTKDVAL-OH
<p>Peptide H-FPTKDVAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LFLRATTEL-OH
<p>Peptide H-LFLRATTEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NQMNLGATL-OH
<p>Peptide H-NQMNLGATL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LL-OH
<p>Peptide H-LL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>3,4,6-Tri-O-acetyl-2-deoxy-D-glucopyranose
CAS:Formula:C12H18O8Purity:>98.0%(GC)Color and Shape:White to Almost white powder to crystalMolecular weight:290.27H-YRNLVWFIKKNTRYP-OH
<p>Peptide H-YRNLVWFIKKNTRYP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FVNQHLCGSHLVEAL-OH
<p>Peptide H-FVNQHLCGSHLVEAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLEWIGAIYPGNGDTSYNQK-OH
<p>Peptide H-GLEWIGAIYPGNGDTSYNQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALQASALAAWGGK-OH
<p>Peptide H-ALQASALAAWGGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLEWVGAIYPGNGDTSYNQK-OH
<p>Peptide H-GLEWVGAIYPGNGDTSYNQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPKLHFYYL-OH
<p>Peptide H-SPKLHFYYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WGNYAYK-OH
<p>Peptide H-WGNYAYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ESYSIYIYK-OH
<p>Peptide H-ESYSIYIYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DDDDDDD-OH
<p>Peptide H-DDDDDDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RAHEEIYHFFFAKKK-OH
<p>Peptide H-RAHEEIYHFFFAKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PLTFGWCFKL-OH
<p>Peptide H-PLTFGWCFKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HQAAMQMLKETINEE-OH
<p>Peptide H-HQAAMQMLKETINEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GDLIAEVETDKATV-OH
<p>Peptide H-GDLIAEVETDKATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGLVTYATYPK-OH
<p>Peptide H-YGLVTYATYPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FAESRIRRETIAAED-OH
<p>Peptide H-FAESRIRRETIAAED-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELDESLQVAER-OH
<p>Peptide H-ELDESLQVAER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLMRTNFLI-OH
<p>Peptide H-RLMRTNFLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KAERADLIAYLKQATAK-OH
<p>Peptide H-KAERADLIAYLKQATAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLACFVLAAV-OH
<p>Peptide H-TLACFVLAAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAVYHHFISDGVR-OH
<p>Peptide H-AAVYHHFISDGVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTVMGGFK-OH
<p>Peptide H-VTVMGGFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YEIVVEAR-OH
<p>Peptide H-YEIVVEAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VEHWGLDKPLLK-OH
<p>Peptide H-VEHWGLDKPLLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NVPLPVIAELPPK-OH
<p>Peptide H-NVPLPVIAELPPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KQIEIKKFK-OH
<p>Peptide H-KQIEIKKFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNLPDYYK-OH
<p>Peptide H-LNLPDYYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DATNVGDEGGFAPNILENK-OH
<p>Peptide H-DATNVGDEGGFAPNILENK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MPFATPMEA-OH
<p>Peptide H-MPFATPMEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVVVGAVGVGK-OH
<p>Peptide H-LVVVGAVGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATVVYQGER-OH
<p>Peptide H-ATVVYQGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TYQRTRALVRTG-OH
<p>Peptide H-TYQRTRALVRTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKAYQLEHTFQGLL-OH
<p>Peptide H-KKAYQLEHTFQGLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELGPYTLDR-OH
<p>Peptide H-ELGPYTLDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VSTLPAITLK-OH
<p>Peptide H-VSTLPAITLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RVPGVAPTL-OH
<p>Peptide H-RVPGVAPTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FGAVYSSDEALIPIR-OH
<p>Peptide H-FGAVYSSDEALIPIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGPESFYCASW-OH
<p>Peptide H-GGPESFYCASW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Amoxicillin Humanized Recombinant Human Monoclonal Antibody
<p>Amoxicillin Humanized Recombinant Human Monoclonal Antibody</p>H-KSKKKKEEE-OH
<p>Peptide H-KSKKKKEEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AFHGDAEAL-OH
<p>Peptide H-AFHGDAEAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVAASQAALG-OH
<p>Peptide H-LVAASQAALG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GQPLSPEK-OH
<p>Peptide H-GQPLSPEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSISIQTEEQIHGK-OH
<p>Peptide H-GSISIQTEEQIHGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILDSFDPLV-OH
<p>Peptide H-ILDSFDPLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GCRDVPMSMRGGDRCG-OH
<p>Peptide H-GCRDVPMSMRGGDRCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLQQFPLDLEK-OH
<p>Peptide H-LLQQFPLDLEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TTLTAAITTVLAK-OH
<p>Peptide H-TTLTAAITTVLAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLAQCFFCFKELEGW-OH
<p>Peptide H-DLAQCFFCFKELEGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAVPDAVGK-OH
<p>Peptide H-AAVPDAVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVLVDLEPGTMDSVR-OH
<p>Peptide H-AVLVDLEPGTMDSVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
