Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,116 products)
- By Biological Target(99,076 products)
- By Pharmacological Effects(6,785 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,698 products)
- Secondary Metabolites(14,220 products)
Found 130579 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-SIRYSFCGNGRHV-OH
<p>Peptide H-SIRYSFCGNGRHV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLQVNSLQTV-OH
<p>Peptide H-DLQVNSLQTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Indocyanine Green
CAS:Formula:C43H47N2NaO6S2Color and Shape:Light yellow to Amber to Dark green powder to crystalMolecular weight:774.97H-DTYIHWVR-OH
<p>Peptide H-DTYIHWVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGEIQPVSVK-OH
<p>Peptide H-GGEIQPVSVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSLWNGPHL-OH
<p>Peptide H-CSLWNGPHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KFNMTGLKRDKKKEY-OH
<p>Peptide H-KFNMTGLKRDKKKEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLHGPLTLNSPLTPEK-OH
<p>Peptide H-GLHGPLTLNSPLTPEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LIFQDK-OH
<p>Peptide H-LIFQDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVFPSIVGRPR-OH
<p>Peptide H-AVFPSIVGRPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAAYSSGAPPMPPF-OH
<p>Peptide H-AAAYSSGAPPMPPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RAYATEPHAK-OH
<p>Peptide H-RAYATEPHAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH
<p>Peptide H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IVGGWECEK-OH
<p>Peptide H-IVGGWECEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLNQFDDAGIVTR-OH
<p>Peptide H-VLNQFDDAGIVTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EALDFFAR-OH
<p>Peptide H-EALDFFAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VDTVDPPYPR-OH
<p>Peptide H-VDTVDPPYPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CLTEYILWV-OH
<p>Peptide H-CLTEYILWV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:1,139.4 g/molH-RGDSPASSPK^-OH
<p>Peptide H-RGDSPASSPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:1,009.07 g/molH-EQLGVRKELRGV-OH
<p>Peptide H-EQLGVRKELRGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLLEMLWRL-OH
<p>Peptide H-YLLEMLWRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CFFQNCPKG-NH2
CAS:<p>H-CFFQNCPKG-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C46H65N13O11S2Molecular weight:1,040.23 g/molH-KAERADLIAYLKQATK-OH
<p>Peptide H-KAERADLIAYLKQATK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EYRHYCYSL-OH
<p>Peptide H-EYRHYCYSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATLTLVSQETR-OH
<p>Peptide H-ATLTLVSQETR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HHHHHHIIKIIK-OH
<p>Peptide H-HHHHHHIIKIIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CVPNGSAYSGDY-OH
<p>Peptide H-CVPNGSAYSGDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLRDLLLIVTR-OH
<p>Peptide H-RLRDLLLIVTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGPLVEQGR^-OH
<p>Peptide H-LGPLVEQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PFRDYVDRFYKTLRA-OH
<p>Peptide H-PFRDYVDRFYKTLRA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVSEIQLMHNLGK-OH
<p>Peptide H-SVSEIQLMHNLGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVVGAVGVGK-OH
<p>Peptide H-VVVGAVGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>A 922500
CAS:<p>Inhibits human and mouse diacylglycerol O-acyltransferase 1 (DGAT-1) with IC50 values of 9 and 22 nM, respectively. Selective for DGAT-1 over DGAT-2 (IC50 = 53 µM), acyl coenzyme A transferase (IC50 = 296 µM) and other acyltransferases. Reduces plasma and liver triglycerides, FFA, chylomicron secretion and increases HDL cholesterol in vivo.</p>Formula:C26H24N2O4Purity:Min. 95%Molecular weight:428.48 g/molH-ILSAIWSGIKSLF-OH
<p>Peptide H-ILSAIWSGIKSLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPGGAWAAEVISNAR-OH
<p>Peptide H-GPGGAWAAEVISNAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTFIIDPGGVIR-OH
<p>Peptide H-GTFIIDPGGVIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QDNEILIFWSK-OH
<p>Peptide H-QDNEILIFWSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FRDYVDRFYKTLRAEQASQE-OH
<p>Peptide H-FRDYVDRFYKTLRAEQASQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSIEGNR-OH
<p>Peptide H-FSIEGNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YALKRQGRTLYG-OH
<p>Peptide H-YALKRQGRTLYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALIVFWKYR-OH
<p>Peptide H-ALIVFWKYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CGGEGYGEGRGDSPG-OH
<p>Peptide H-CGGEGYGEGRGDSPG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGEGWPYIACRTSVVGRAWE-OH
<p>Peptide H-SGEGWPYIACRTSVVGRAWE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FQIVNPHLL-OH
<p>Peptide H-FQIVNPHLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MTEQQWNFAGIEAAASAIQG-OH
<p>Peptide H-MTEQQWNFAGIEAAASAIQG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MHRSDLMSAAVR-OH
<p>Peptide H-MHRSDLMSAAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HVPGGGSVQIVYKPVDLSK-OH
<p>Peptide H-HVPGGGSVQIVYKPVDLSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SNGNFIAPEYAYKIVK-OH
<p>Peptide H-SNGNFIAPEYAYKIVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YYSTAASSL-OH
<p>Peptide H-YYSTAASSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TATSEYQTFFNPR-OH
<p>Peptide H-TATSEYQTFFNPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CGSLGNIHHKPGGGQVEVK-OH
<p>Peptide H-CGSLGNIHHKPGGGQVEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKKKKKKK-OH
<p>Peptide H-KKKKKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALWEIQQVV-OH
<p>Peptide H-ALWEIQQVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IFLAGDKDNVIDQIEK-OH
<p>Peptide H-IFLAGDKDNVIDQIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ANAAAAKIQASFRGHMARKKIKSG-OH
<p>Peptide H-ANAAAAKIQASFRGHMARKKIKSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NTDGSTDYGILQINSR-OH
<p>Peptide H-NTDGSTDYGILQINSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELYK-OH
<p>Peptide H-ELYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVSELPIMHQDWLNGK-OH
<p>Peptide H-SVSELPIMHQDWLNGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PQGRIVGGK-OH
<p>Peptide H-PQGRIVGGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MLWRRKIGPQMTLSHAAG-OH
<p>Peptide H-MLWRRKIGPQMTLSHAAG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ADSSPVK-OH
<p>Peptide H-ADSSPVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AEDNADTLALVFEAPNQEK-OH
<p>Peptide H-AEDNADTLALVFEAPNQEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NTRPPLGNWF-OH
<p>Peptide H-NTRPPLGNWF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DSTGSFVLPFR-OH
<p>Peptide H-DSTGSFVLPFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLHDDLLEA-OH
<p>Peptide H-VLHDDLLEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLDHWLGAPAPYPDPLEPK-OH
<p>Peptide H-YLDHWLGAPAPYPDPLEPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Apraglutide TFA
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C172H263N43O52·C2HF3O2Molecular weight:3,879.27 g/molH-ERCPHRPIL-OH
<p>Peptide H-ERCPHRPIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLLTSSKGQLQK-OH
<p>Peptide H-SLLTSSKGQLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVETIK-OH
<p>Peptide H-SVETIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EHMQPTHPIR-OH
<p>Peptide H-EHMQPTHPIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HSQPWQVLVASR-OH
<p>Peptide H-HSQPWQVLVASR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTVNLTWSR-OH
<p>Peptide H-GTVNLTWSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TGGFTFGTAKTA-OH
<p>Peptide H-TGGFTFGTAKTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YYNNDLLR-OH
<p>Peptide H-YYNNDLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGANLFELENFVAR-OH
<p>Peptide H-AGANLFELENFVAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVAGVANALAHK-OH
<p>Peptide H-VVAGVANALAHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YFPDWQNYT-OH
<p>Peptide H-YFPDWQNYT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLSIPTVFFLR-OH
<p>Peptide H-YLSIPTVFFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HKSNTCRAMER-OH
<p>Peptide H-HKSNTCRAMER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GNLEWK-OH
<p>Peptide H-GNLEWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Leupeptin HCl
CAS:<p>Leupeptin HCl is a drug that inhibits the activity of proteases. It has been shown to have anti-tuberculosis properties and has been used in combination with other drugs for this purpose. Leupeptin HCl binds to the catalytic site of the enzyme, which prevents access by substrates and competitive inhibitors, thus inhibiting its activity. The drug has also been shown to inhibit mitochondrial membrane potential in damaged cells; it blocks calcium ion influx through voltage-dependent channels in damaged cells and protects against cytosolic calcium overload. Leupeptin HCl has been shown to have locomotor stimulant effects on rats, as well as biological properties such as binding to monoclonal antibodies or eosinophil peroxidase.</p>Formula:C20H38N6O4·HClPurity:Min. 95%Color and Shape:PowderMolecular weight:463.01 g/molH-MASMTGGQQMGR-OH
<p>Peptide H-MASMTGGQQMGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLGPVGFMK-OH
<p>Peptide H-SLGPVGFMK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TDHGAEIVYKSPVVSGDTSPR-OH
<p>Peptide H-TDHGAEIVYKSPVVSGDTSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AIIRILQQL-OH
<p>Peptide H-AIIRILQQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IQSFLGGAPTEDLK-OH
<p>Peptide H-IQSFLGGAPTEDLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EVHHQKLV-NH2
<p>Peptide H-EVHHQKLV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RKRKRKRK-OH
<p>Peptide H-RKRKRKRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TCVADESAENCDK-OH
<p>Peptide H-TCVADESAENCDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RARFP-OH
<p>Peptide H-RARFP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WIFPWIQL-OH
<p>Peptide H-WIFPWIQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TGTTVPESIHSFIGDGLVKPEALNK-OH
<p>Peptide H-TGTTVPESIHSFIGDGLVKPEALNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGEAAEAEAEK-OH
<p>Peptide H-GGEAAEAEAEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLLGIGILTV-OH
<p>Peptide H-LLLGIGILTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YSQAVPAVTEGPIPEVLK-OH
<p>Peptide H-YSQAVPAVTEGPIPEVLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TMRGKKKRTRAN-OH
<p>Peptide H-TMRGKKKRTRAN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGYLMELCC-OH
<p>Peptide H-AGYLMELCC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLSKGCFGLKLDRIGSMSGLGC-OH
<p>H-GLSKGCFGLKLDRIGSMSGLGC-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-DLPQGFSALEPLVDLPIGINITR-OH
<p>Peptide H-DLPQGFSALEPLVDLPIGINITR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RSRHSSYPAGT-OH
<p>Peptide H-RSRHSSYPAGT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QGPKEPFRDYVDRFY-OH
<p>Peptide H-QGPKEPFRDYVDRFY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ITTESIVIW-OH
<p>Peptide H-ITTESIVIW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VKDLATVYVDVLK-OH
<p>Peptide H-VKDLATVYVDVLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Goat IgG Serum
<p>Please enquire for more information about Goat IgG Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-YLVPDLVQEYIEK-OH
<p>Peptide H-YLVPDLVQEYIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVGKLNWASQIY-OH
<p>Peptide H-LVGKLNWASQIY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AFAHAQWK-OH
<p>Peptide H-AFAHAQWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAH-OH
<p>Peptide H-TRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSNLQEQIGW-OH
<p>Peptide H-TSNLQEQIGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FVYGGSKTSL-OH
<p>Peptide H-FVYGGSKTSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YNGIITDTIK-OH
<p>Peptide H-YNGIITDTIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNSQSLSPYLFR-OH
<p>Peptide H-VNSQSLSPYLFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KSAPATGGVKKPHR-OH
<p>Peptide H-KSAPATGGVKKPHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGADMEDVR-OH
<p>Peptide H-LGADMEDVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIIQFERL-OH
<p>Peptide H-SIIQFERL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SDYGERLI-OH
<p>Peptide H-SDYGERLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GFEPTLEALFGK-OH
<p>Peptide H-GFEPTLEALFGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cantharidin
CAS:Formula:C10H12O4Purity:>98.0%(GC)Color and Shape:White to Almost white powder to crystalMolecular weight:196.20H-LQTAPVPMPDLK-OH
<p>Peptide H-LQTAPVPMPDLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TKSSLPGQTK-OH
<p>Peptide H-TKSSLPGQTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ETIPLQETSLYTQDR-OH
<p>Peptide H-ETIPLQETSLYTQDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AWTDVLPWK-OH
<p>Peptide H-AWTDVLPWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGPGRAFYAR-OH
<p>Peptide H-IGPGRAFYAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FFRDHSYQE-OH
<p>Peptide H-FFRDHSYQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNQLESK-OH
<p>Peptide H-LNQLESK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NFPQSRPEPTAPPAE-OH
<p>Peptide H-NFPQSRPEPTAPPAE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLEETSVML-OH
<p>Peptide H-VLEETSVML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIAQDFK-OH
<p>Peptide H-EIAQDFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLAEVATGEK-OH
<p>Peptide H-YLAEVATGEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AQQHYPVSAGYTK-OH
<p>Peptide H-AQQHYPVSAGYTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLWAQCVQL-OH
<p>Peptide H-KLWAQCVQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FFGVGGEEDITVQTVTWPDMELPLPRNITEGE-OH
<p>Peptide H-FFGVGGEEDITVQTVTWPDMELPLPRNITEGE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGCMPYVRIPTA-OH
<p>Peptide H-AGCMPYVRIPTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGVAGQWR-OH
<p>Peptide H-LGVAGQWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SNYVLKGHRDVQR-OH
<p>Peptide H-SNYVLKGHRDVQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGFLHSGTAK-OH
<p>Peptide H-LGFLHSGTAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EVYDFAFR-OH
<p>Peptide H-EVYDFAFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSISIQTEEK-OH
<p>Peptide H-GSISIQTEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGEFSGANK-OH
<p>Peptide H-VGEFSGANK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLWQWRKSL-OH
<p>Peptide H-DLWQWRKSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TYLPTNASL-OH
<p>Peptide H-TYLPTNASL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STMMSRSHKTRSHHV-OH
<p>Peptide H-STMMSRSHKTRSHHV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PSKPSFQEFVDWENVSPELNSTDQPFL-OH
<p>Peptide H-PSKPSFQEFVDWENVSPELNSTDQPFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GHQAAMQML-OH
<p>Peptide H-GHQAAMQML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSISWAR-OH
<p>Peptide H-FSISWAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSVSDYVNYDIIVR-OH
<p>Peptide H-SSVSDYVNYDIIVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CRRRRRRRRR-OH
<p>Peptide H-CRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILDTAGQEEY-OH
<p>Peptide H-ILDTAGQEEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QIYAGIKVK-OH
<p>Peptide H-QIYAGIKVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IPVIGPLK-OH
<p>Peptide H-IPVIGPLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSLEGSR-OH
<p>Peptide H-FSLEGSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLTSVINQK-OH
<p>Peptide H-GLTSVINQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QLVQSGAEV-OH
<p>Peptide H-QLVQSGAEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLYDDNQRV-OH
<p>Peptide H-FLYDDNQRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WYQSIR-OH
<p>Peptide H-WYQSIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIITFEKL-OH
<p>Peptide H-SIITFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CLAVEEVSL-OH
<p>Peptide H-CLAVEEVSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MVWESGCTV-OH
<p>Peptide H-MVWESGCTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLFER-OH
<p>Peptide H-LLFER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MLLVFGIDV-OH
<p>Peptide H-MLLVFGIDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QAVHAAHAEIN-OH
<p>Peptide H-QAVHAAHAEIN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALQASALNAWR-OH
<p>Peptide H-ALQASALNAWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NFMESLPRLGMH-NH2
<p>Peptide H-NFMESLPRLGMH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPIPLPY-OH
<p>Peptide H-FPIPLPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Avelumab - in PBS buffer
CAS:<p>Monoclonal antibody against PDL-1; targeted immunotherapy for cancer</p>Purity:Min. 95%Purified NGAL Detecting Antibody
<p>Please enquire for more information about Purified NGAL Detecting Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-LGL-OH
<p>Peptide H-LGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGTGGFGNVIR-OH
<p>Peptide H-LGTGGFGNVIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VSFELFADK-OH
<p>Peptide H-VSFELFADK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAPVNISSSDLTGR-OH
<p>Peptide H-GAPVNISSSDLTGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GATQQILDEAER-OH
<p>Peptide H-GATQQILDEAER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSPDDSAGASALLR-OH
<p>Peptide H-FSPDDSAGASALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DSGSPNPAR-OH
<p>Peptide H-DSGSPNPAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GHDVTFYK-OH
<p>Peptide H-GHDVTFYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LYDLLLEML-OH
<p>Peptide H-LYDLLLEML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MPFEF-OH
<p>Peptide H-MPFEF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILGLNKIV-OH
<p>Peptide H-ILGLNKIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QLLLSAALSAGK-OH
<p>Peptide H-QLLLSAALSAGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EAYEMPSEEGYQDYEPEA-OH
<p>Peptide H-EAYEMPSEEGYQDYEPEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ANERADLIAYLKQATK-OH
<p>Peptide H-ANERADLIAYLKQATK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CVNGVCWTV-OH
<p>Peptide H-CVNGVCWTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LEDVFAGK-OH
<p>Peptide H-LEDVFAGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DVNAAIAAIK-OH
<p>Peptide H-DVNAAIAAIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Modified Timbetasin (TMSB4X) peptide
<p>Modified Thymosin beta-4 protein that in humans is encoded by the TMSB4X gene. Additional Met residue at N terminus.</p>Formula:C215H357N57O78S2Molecular weight:5,052.88 g/molH-KYQEFFWDANDIYRI-OH
<p>Peptide H-KYQEFFWDANDIYRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DYKDDDDKPAYSSGAPPMPPF-OH
<p>Peptide H-DYKDDDDKPAYSSGAPPMPPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VALPHRTAC-OH
<p>Peptide H-VALPHRTAC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QLQPFPQPQLPY-OH
<p>Peptide H-QLQPFPQPQLPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HHGPTITAK-OH
<p>Peptide H-HHGPTITAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APAHRSSTFPKWVTKTERGRQPLRS-OH
<p>Peptide H-APAHRSSTFPKWVTKTERGRQPLRS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VITPGTNTSNQVAVL-OH
<p>Peptide H-VITPGTNTSNQVAVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ENQLEVLEVSWLHGLK-OH
<p>Peptide H-ENQLEVLEVSWLHGLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MVRRFLVTLRIRRACGPPRV-OH
<p>Peptide H-MVRRFLVTLRIRRACGPPRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ONO4057
CAS:<p>ONO4057 is a research tool that is used in cell biology to study the interactions between proteins, peptides and other biomolecules. It is also used as an inhibitor for ion channels, which are membrane-spanning proteins that allow ions to pass through the cell membrane. ONO4057 has been shown to inhibit potassium channels, calcium channels, and sodium channels. This compound has also been shown to be able to activate some ligand-gated ion channels such as nicotinic acetylcholine receptors.</p>Formula:C27H34O7Purity:Min. 95%Molecular weight:470.6 g/molH-LLDFVRMGV-OH
<p>Peptide H-LLDFVRMGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVNELTEFAK-OH
<p>Peptide H-LVNELTEFAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WLQYFPNPV-OH
<p>Peptide H-WLQYFPNPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Palifosfamide
CAS:<p>Active metabolite of ifosfamide; alkylates and cross-links DNA; antineoplastic</p>Formula:C4H11Cl2N2O2PPurity:Min. 95%Color and Shape:SolidMolecular weight:221.02 g/mol
