Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,104 products)
- By Biological Target(99,074 products)
- By Pharmacological Effects(6,784 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,693 products)
- Secondary Metabolites(14,218 products)
Found 130576 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-ALVLIAFAQYLQQCPFEDHVK-OH
<p>Peptide H-ALVLIAFAQYLQQCPFEDHVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C114H173N27O30SPurity:(%) Min. 95%Molecular weight:2,433.9 g/molH-IGRFYIQM-OH
<p>Peptide H-IGRFYIQM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LAAFPEDR-OH
<p>Peptide H-LAAFPEDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VCYDKSFPISHVR-OH
<p>Peptide H-VCYDKSFPISHVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FEGDTLVNR-OH
<p>Peptide H-FEGDTLVNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YEFLWGPRA-OH
<p>Peptide H-YEFLWGPRA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLCLRFLSK-OH
<p>Peptide H-KLCLRFLSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVRDRLARL-OH
<p>Peptide H-SVRDRLARL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TTEFWK-OH
<p>Peptide H-TTEFWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VFIGVNDLER-OH
<p>Peptide H-VFIGVNDLER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLNLGPITR-OH
<p>Peptide H-VLNLGPITR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLGYLILGV-OH
<p>Peptide H-FLGYLILGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IAEYMNHLIDIGVAGFR-OH
<p>Peptide H-IAEYMNHLIDIGVAGFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPNVNIHNF-OH
<p>Peptide H-YPNVNIHNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSEVNL-OH
<p>Peptide H-CSEVNL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DIVVLGVEK-OH
<p>Peptide H-DIVVLGVEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASGFTFMSSAVQWVR-OH
<p>Peptide H-ASGFTFMSSAVQWVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLTEILK-OH
<p>Peptide H-SLTEILK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MASMTGGQQMGR-OH
<p>Peptide H-MASMTGGQQMGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGFLHSGTAK-OH
<p>Peptide H-LGFLHSGTAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GHQAAMQML-OH
<p>Peptide H-GHQAAMQML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFCGTPEYLAPEVLEDNDYGR-OH
<p>Peptide H-TFCGTPEYLAPEVLEDNDYGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AYEQNPQHFIEDLEK-OH
<p>Peptide H-AYEQNPQHFIEDLEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SWFEPLVEDMQR-OH
<p>Peptide H-SWFEPLVEDMQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPIESHQVEKR-OH
<p>Peptide H-TPIESHQVEKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NVFDEAILAALEPPEPK-OH
<p>Peptide H-NVFDEAILAALEPPEPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FRF-OH
<p>Peptide H-FRF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ISFNFFVTAPK-OH
<p>Peptide H-ISFNFFVTAPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GNLIAPWYAFALSRG-OH
<p>Peptide H-GNLIAPWYAFALSRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGGGGC-OH
<p>Peptide H-GGGGGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(-)-Deguelin
CAS:Formula:C23H22O6Purity:>95.0%(HPLC)Color and Shape:White to Yellow to Green powder to crystalMolecular weight:394.42H-CPKRRRLSSSLNPS-OH
<p>Peptide H-CPKRRRLSSSLNPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NCYFPLQSY-OH
<p>Peptide H-NCYFPLQSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PKTPKKAKKL-OH
<p>Peptide H-PKTPKKAKKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILDTAGLEEY-OH
<p>Peptide H-ILDTAGLEEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RAEQASQEVKNWMTE-OH
<p>Peptide H-RAEQASQEVKNWMTE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LDLSSLAYSGK-OH
<p>Peptide H-LDLSSLAYSGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPMTYKAAL-OH
<p>Peptide H-RPMTYKAAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HQPANDPSWYTG-OH
<p>Peptide H-HQPANDPSWYTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NIIQFVHGEEDLK-OH
<p>Peptide H-NIIQFVHGEEDLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IEALIR-OH
<p>Peptide H-IEALIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RKVAELVHFLLLKYR-OH
<p>Peptide H-RKVAELVHFLLLKYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>4-(4,6-Dimethoxy-1,3,5-triazin-2-yl)-4-methylmorpholinium Chloride
CAS:Formula:C10H17ClN4O3Purity:>95.0%(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:276.72H-AFHHVAREL-OH
<p>Peptide H-AFHHVAREL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YAPPITGQI-OH
<p>Peptide H-YAPPITGQI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SYGIPFIETSAK-OH
<p>Peptide H-SYGIPFIETSAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALLPAVPSL-OH
<p>Peptide H-ALLPAVPSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLIYGATNLADGVPSR-OH
<p>Peptide H-LLIYGATNLADGVPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPRPHIGDTL-OH
<p>Peptide H-GPRPHIGDTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YVDDVVLGA-OH
<p>Peptide H-YVDDVVLGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFSTASAITPSVSR-OH
<p>Peptide H-SFSTASAITPSVSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VSLSYR-OH
<p>Peptide H-VSLSYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPEAPPSVR-OH
<p>Peptide H-YPEAPPSVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CMRVSESAC-OH
<p>Peptide H-CMRVSESAC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VRKKNMAKQA-OH
<p>Peptide H-VRKKNMAKQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPSYAYHQF-OH
<p>Peptide H-SPSYAYHQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C52H64N12O14Molecular weight:1,099.15 g/molH-LLL-OH
<p>Peptide H-LLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ITT-OH
<p>Peptide H-ITT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DASGATFTWTPSSGK-OH
<p>Peptide H-DASGATFTWTPSSGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRRR-OH
<p>Peptide H-RRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CGKRK-OH
<p>Peptide H-CGKRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTDHYFLRY-OH
<p>Peptide H-DTDHYFLRY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKRPQRATSNVFC-OH
<p>Peptide H-KKRPQRATSNVFC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGSLQPLALEGSLQKRG-OH
<p>Peptide H-AGSLQPLALEGSLQKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVEPQLEDDER-OH
<p>Peptide H-AVEPQLEDDER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVGARGVGK-OH
<p>Peptide H-VVGARGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TVF-OH
<p>Peptide H-TVF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CYENPQVIASQQL-OH
<p>Peptide H-CYENPQVIASQQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPSEFDLSAFLR-OH
<p>Peptide H-LPSEFDLSAFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTDVQAWIR-OH
<p>Peptide H-GTDVQAWIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CVLHVMNGAVMYQIDSVVR-OH
<p>Peptide H-CVLHVMNGAVMYQIDSVVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IRQYLAQWLE-OH
<p>Peptide H-IRQYLAQWLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSDIAGTTSTLQEQIGWMTN-OH
<p>Peptide H-GSDIAGTTSTLQEQIGWMTN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GFQALGDAADIR-OH
<p>Peptide H-GFQALGDAADIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GQGFSYPYKAVFSTQ-OH
<p>Peptide H-GQGFSYPYKAVFSTQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSQAPNPVDDESWD-OH
<p>Peptide H-SSQAPNPVDDESWD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DCKTILKAL-OH
<p>Peptide H-DCKTILKAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VISPSEDR-OH
<p>Peptide H-VISPSEDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YQGFIFDIVTK-OH
<p>Peptide H-YQGFIFDIVTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLSLSPGK-OH
<p>Peptide H-SLSLSPGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GVNDNEEGFFSAR-OH
<p>Peptide H-GVNDNEEGFFSAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLSDGEWQLVLNVWGK-OH
<p>Peptide H-GLSDGEWQLVLNVWGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVQAFQFTDK-OH
<p>Peptide H-LVQAFQFTDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KCIDFYSRI-OH
<p>Peptide H-KCIDFYSRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLQDSVDFSL-OH
<p>Peptide H-LLQDSVDFSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QDPDNTDDNGPQDPDNTDDN-OH
<p>Peptide H-QDPDNTDDNGPQDPDNTDDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLNQ-OH
<p>Peptide H-DLNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSVYWAQADR-OH
<p>Peptide H-FSVYWAQADR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RGFFYTPKTRRE-OH
<p>Peptide H-RGFFYTPKTRRE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GWNWTSGFNK-OH
<p>Peptide H-GWNWTSGFNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVRI-OH
<p>Peptide H-AVRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WEH-OH
<p>Peptide H-WEH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NQLTSNPENTVFDAK-OH
<p>Peptide H-NQLTSNPENTVFDAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPEFWR-OH
<p>Peptide H-GPEFWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CCLCLTVFL-OH
<p>Peptide H-CCLCLTVFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSCSSCPLSK-OH
<p>Peptide H-SSCSSCPLSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KPIVQYDNF-OH
<p>Peptide H-KPIVQYDNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VAGFNLLMTLR-OH
<p>Peptide H-VAGFNLLMTLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLSVNDLPVGR-OH
<p>Peptide H-HLSVNDLPVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLQEINAYIGHSVEK-OH
<p>Peptide H-NLQEINAYIGHSVEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKDNAYPTI-OH
<p>Peptide H-KKDNAYPTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VEIFYR-OH
<p>Peptide H-VEIFYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C40H57N9O9Molecular weight:825.95 g/molH-LLIYSASYR-OH
<p>Peptide H-LLIYSASYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LWSAEIPNLYR-OH
<p>Peptide H-LWSAEIPNLYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GVQIPLPEGINFVR-OH
<p>Peptide H-GVQIPLPEGINFVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DSGSPNPAR-OH
<p>Peptide H-DSGSPNPAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LADGGATNQGR-OH
<p>Peptide H-LADGGATNQGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTADK-OH
<p>Peptide H-LTADK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSSDVDQLGK-OH
<p>Peptide H-GSSDVDQLGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGL-OH
<p>Peptide H-LGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DGD-OH
<p>Peptide H-DGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTDILAAFR-OH
<p>Peptide H-DTDILAAFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLGGALQAK-OH
<p>Peptide H-KLGGALQAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GQYCYELDEK-OH
<p>Peptide H-GQYCYELDEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STGGKAPRK-OH
<p>Peptide H-STGGKAPRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KYF-OH
<p>Peptide H-KYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:456.5 g/molH-SGTASVVCLLNNFYPR-OH
<p>Peptide H-SGTASVVCLLNNFYPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NTQPIMDTDGSYFVYSK-OH
<p>Peptide H-NTQPIMDTDGSYFVYSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NFMESLPRLGMH-NH2
<p>Peptide H-NFMESLPRLGMH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIYKRWIIL-OH
<p>Peptide H-EIYKRWIIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPEVLLGSAR-OH
<p>Peptide H-SPEVLLGSAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CFIVYIIFVYIPLFLIHTHARFLIT-OH
<p>Peptide H-CFIVYIIFVYIPLFLIHTHARFLIT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGGDGSFSGFGDGSFSGFG-OH
<p>Peptide H-GGGDGSFSGFGDGSFSGFG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YKTLRAEQASQEVKN-OH
<p>Peptide H-YKTLRAEQASQEVKN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KRFYGGMWKK-OH
<p>Peptide H-KRFYGGMWKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GEALSTLVVNKIRGT-OH
<p>Peptide H-GEALSTLVVNKIRGT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALQASALNAWR-OH
<p>Peptide H-ALQASALNAWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KALN-OH
<p>Peptide H-KALN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GWIFGTTLDSK-OH
<p>Peptide H-GWIFGTTLDSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AFVDFLSDEIK-OH
<p>Peptide H-AFVDFLSDEIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QAVHAAHAEIN-OH
<p>Peptide H-QAVHAAHAEIN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QLSSTVFK-OH
<p>Peptide H-QLSSTVFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>1-O-Hexadecyl-2-O-methyl-rac-glycerol
CAS:<p>1-O-Hexadecyl-2-O-methyl-rac-glycerol is a metabolite of phosphatidylethanolamine that is structurally related to the neurotransmitter serotonin. It binds to the 5HT7 receptor, which is involved in the regulation of infectious diseases and cytokine production. 1-O-Hexadecyl-2-O-methyl-racglycerol has been shown to stimulate growth factor production and protein synthesis, as well as inhibit serotonin reuptake. This compound also activates phosphorylation of PKC, which leads to an increase in cytosolic calcium levels and activation of PKC. As a result, diacylglycerol levels are increased, leading to an increase in mitochondrial membrane potential and camp levels.</p>Formula:C20H42O3Purity:Min. 95%Molecular weight:330.55 g/molH-LVTLVFV-OH
<p>Peptide H-LVTLVFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLFER-OH
<p>Peptide H-LLFER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VERYLRDQQLLGIWG-OH
<p>Peptide H-VERYLRDQQLLGIWG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CRRRRRRRRR-OH
<p>Peptide H-CRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LDIDSPPITAR-OH
<p>Peptide H-LDIDSPPITAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STHVNHLHC-OH
<p>Peptide H-STHVNHLHC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTGNLELVAVR-OH
<p>Peptide H-GTGNLELVAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YSAELHVAHWNSAK-OH
<p>Peptide H-YSAELHVAHWNSAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STMMSRSHKTRSHHV-OH
<p>Peptide H-STMMSRSHKTRSHHV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DIDEVSSLLR-OH
<p>Peptide H-DIDEVSSLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SITEVECFL-OH
<p>Peptide H-SITEVECFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CINGVCWTV-OH
<p>Peptide H-CINGVCWTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Amoxicillin Humanized Recombinant Human Monoclonal Antibody
<p>Amoxicillin Humanized Recombinant Human Monoclonal Antibody</p>H-LQTAPVPMPDLK-OH
<p>Peptide H-LQTAPVPMPDLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKYKK-OH
<p>Peptide H-KKYKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GIINTLQK-OH
<p>Peptide H-GIINTLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APVPTKTK-OH
<p>Peptide H-APVPTKTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QGPKEPFRDYVDRFY-OH
<p>Peptide H-QGPKEPFRDYVDRFY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>DHEA 3-Sulphate Mouse Monoclonal Antibody
<p>Mouse Monoclonal Antibody against Dehydroepiandrosterone 3-Sulphate (DHEA 3-Sulphate), an adrenal androstane steroid. and metabolite of DHEA. This mAb has been purified by DEAE column chromatography.</p>H-IGFPWSEIR-OH
<p>Peptide H-IGFPWSEIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Lonafarnib
CAS:<p>Lonafarnib is a selective, non-peptidomimetic competitive inhibitor of farnesyl trasferase with IC50 of 1.9nM. Farneslyl transferase is involved in post-translational lipid modifications of H-Ras, progerin and other farnesylated proteins, and plays a role in cancer as well as in a rare genetic disease known as progeria or Hutchinson-Gilford syndrome, causing premature and rapid aging.</p>Formula:C27H31Br2ClN4O2Purity:Min. 95%Molecular weight:638.82 g/molH-GSEELRSLY-OH
<p>Peptide H-GSEELRSLY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGPALATGNVVVMK-OH
<p>Peptide H-LGPALATGNVVVMK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IPKLVANNT-OH
<p>Peptide H-IPKLVANNT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRYCKSTEL-OH
<p>Peptide H-RRYCKSTEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLIYWASTR-OH
<p>Peptide H-LLIYWASTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KFYSKISEY-OH
<p>Peptide H-KFYSKISEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YVGGQEHFAHLLILR-OH
<p>Peptide H-YVGGQEHFAHLLILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IDPNAWVER-OH
<p>Peptide H-IDPNAWVER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TQLNRALTGIAVEQD-OH
<p>Peptide H-TQLNRALTGIAVEQD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KALVINHV-OH
<p>Peptide H-KALVINHV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EHMQPTHPIR-OH
<p>Peptide H-EHMQPTHPIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLFGYPVYV-OH
<p>Peptide H-LLFGYPVYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Apraglutide TFA
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C172H263N43O52·C2HF3O2Molecular weight:3,879.27 g/molH-TEDTIFLR-OH
<p>Peptide H-TEDTIFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LISEIDLLR-OH
<p>Peptide H-LISEIDLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TDAATLAQEAGNFER-OH
<p>Peptide H-TDAATLAQEAGNFER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPLNVLKPR-OH
<p>Peptide H-DPLNVLKPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VYSTSVTGSR-OH
<p>Peptide H-VYSTSVTGSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAGGVGKSAL-OH
<p>Peptide H-GAGGVGKSAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GNLDFVQPPR-OH
<p>Peptide H-GNLDFVQPPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FIT-OH
<p>Peptide H-FIT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VMAPRTLL-OH
<p>Peptide H-VMAPRTLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLLGDGPVVTDPK-OH
<p>Peptide H-TLLGDGPVVTDPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VMNILLQYVV-OH
<p>Peptide H-VMNILLQYVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Clopidogrel carboxylic acid
CAS:<p>Clopidogrel is a potent inhibitor of the platelet aggregation. It reduces blood clotting by inhibiting the ADP receptor on the surface of platelets, thereby inhibiting the aggregation and adhesion of platelets. Clopidogrel has been shown to be effective in preventing thrombosis, myocardial infarction (heart attack), and stroke. Clopidogrel inhibits the activity of cytochrome P450 3A4 (CYP3A4) and p2Y 12 receptors. Clopidogrel has been shown to have synergic effects with nonsteroidal anti-inflammatory drugs (NSAIDs). The polymorphic nature of Clopidogrel can be monitored using a liquid chromatography-tandem mass spectrometry (LC-MS/MS) method for quantification in biological samples such as human serum and plasma.</p>Formula:C15H14ClNO2SPurity:Min. 95%Molecular weight:307.8 g/molH-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH
<p>Peptide H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLIGLDLLYGELQDSDDF-OH
<p>Peptide H-VLIGLDLLYGELQDSDDF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLEWRFDSRL-OH
<p>Peptide H-VLEWRFDSRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AYPPGAPPMPPF-OH
<p>Peptide H-AYPPGAPPMPPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NYNYLYRLF-OH
<p>Peptide H-NYNYLYRLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIFSAVLDELK-OH
<p>Peptide H-SIFSAVLDELK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLFGVLRLK-OH
<p>Peptide H-KLFGVLRLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKKKKKKK-OH
<p>Peptide H-KKKKKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TEAPSATGQASSLLGGR-OH
<p>Peptide H-TEAPSATGQASSLLGGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGANLFELENFVAR-OH
<p>Peptide H-AGANLFELENFVAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVVGAVGVGK-OH
<p>Peptide H-VVVGAVGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLYDGREHSV-OH
<p>Peptide H-GLYDGREHSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LYLVCGERG-OH
<p>Peptide H-LYLVCGERG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILRKLLQE-OH
<p>Peptide H-ILRKLLQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IADYNYK-OH
<p>Peptide H-IADYNYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATTNILEHY-OH
<p>Peptide H-ATTNILEHY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TDLQERGDNDISPFSGDGQPFKD-OH
<p>Peptide H-TDLQERGDNDISPFSGDGQPFKD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DFINWLIQTK-OH
<p>Peptide H-DFINWLIQTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VADFGLAR-OH
<p>Peptide H-VADFGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATLTLVSQETR-OH
<p>Peptide H-ATLTLVSQETR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
