Biochemicals and Reagents

<p>GK antibody was raised using the middle region of GK corresponding to a region with amino acids MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ASPHD2 antibody, catalog no. 70R-3531</p>

<p>The GR antibody is a highly specialized antibody that targets the p38 MAPK pathway. It has antiviral properties and is particularly effective against acidic environments. This antibody specifically interacts with β-catenin, a protein involved in cell adhesion and signaling pathways. It also binds to nuclear factor kappa-light-chain-enhancer, which regulates gene expression. The GR antibody is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications in life sciences research. It can be used in immunoassays to detect the presence of activated p38 mitogen-activated protein kinase (MAPK) and caspase-9, as well as growth factors. With its high specificity and sensitivity, the GR antibody is an invaluable tool for researchers studying various cellular processes and signaling pathways.</p>

<p>Nortriptyline Conjugate for use in immunoassays</p>

<p>Recombinant human DHRS4 protein (His tag)</p>

<p>Rabbit polyclonal 5HT4 antibody</p>

<p>1-217 amino acids: MGSSHHHHHH SSGLVPRGSH MEAIAKYDFK ATADDELSFK RGDILKVLNE ECDQNWYKAE LNGKDGFIPK NYIEMKPHPW FFGKIPRAKA EEMLSKQRHD GAFLIRESES APGDFSLSVK FGNDVQHFKV LRDGAGKYFL WVVKFNSLNE LVDYHRSTSV SRNQQIFLRD IEQVPQQPTY VQALFDFDPQ EDGELGFRRG DFIHVMDNSD PNWWKGACHG QTGMFPRNYV TPVNRNV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LPA antibody, catalog no. 70R-10023</p>

<p>Rabbit polyclonal Tau antibody (Thr231)</p>

<p>Rabbit polyclonal COT antibody (Thr290)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CEBPD antibody, catalog no. 70R-8265</p>

<p>The STAR antibody is a highly specialized monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to glial fibrillary acidic protein (GFAP), a protein primarily found in the cytoskeleton of astrocytes. This antibody has been extensively validated for its high specificity and sensitivity in detecting GFAP expression in various tissues and cell types.</p>

<p>The TRIM38 antibody is a powerful tool used in the field of biomedical research. It is a polyclonal antibody that specifically targets TRIM38, an oxidase-like protein involved in various cellular processes. This antibody can be used to detect and quantify TRIM38 in pluripotent stem cells, making it an essential component for studying the role of this protein in stem cell biology.</p>

<p>PYY antibody was raised using the middle region of PYY corresponding to a region with amino acids APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED</p>

<p>Salicyclic Acid Conjugate for use in immunoassays</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHTF18 antibody, catalog no. 70R-3758</p>

<p>The PCT monoclonal antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets annexin, a protein involved in the regulation of phosphorylcholine. This monoclonal antibody is produced by a hybridoma cell strain, which is a fusion of two different types of cells - a B-cell and a myeloma cell.</p>

<p>TNF alpha antibody was raised in mouse using human recombinant tumor necrosis factor alpha as the immunogen.</p>

<p>Purified recombinant SORBS3 protein (His tag)</p>

<p>RAB10 antibody was raised in Mouse using a purified recombinant fragment of human RAB10 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal SFRS17A antibody</p>

<p>MDIAIHHPWI RRPFFPFHSP SRLFDQFFGE HLLESDLFPT STSLSPFYLR PPSFLRAPSW FDTGLSEMRL EKDRFSVNLD VKHFSPEELK VKVLGDVIEV HGKHEERQDE HGFISREFHR KYRIPADVDP LTITSSLSSD GVLTVNGPRK QVSGPERTIP ITREEKPAVT AAPKK</p>

<p>Purified Polyclonal MRPS12 antibody</p>

<p>Rabbit polyclonal RSK1/2/3/4 antibody (Ser221/227/218/232)</p>

<p>NOLA3 antibody was raised using the middle region of Nola3 corresponding to a region with amino acids MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK</p>

<p>Rabbit Polyclonal Chk1 antibody (Ser345)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C14ORF156 antibody, catalog no. 70R-4685</p>

<p>Rabbit polyclonal RGS13 antibody</p>

<p>Rabbit polyclonal AHSA1 antibody</p>

<p>CDK7 antibody was raised in Rabbit using Human CDK7 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MTHFD2L antibody, catalog no. 70R-3409</p>

<p>ACDC antibody was raised using the N terminal Of Acdc corresponding to a region with amino acids KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIP</p>

<p>Recombinant human ATF1 protein (His tag)</p>

<p>Mouse thrombocyte antibody was raised in rabbit using mouse thrombocytes as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ20674 antibody, catalog no. 70R-7427</p>

<p>Mouse monoclonal CP15 antibody</p>

<p>Purified Polyclonal ANAPC1 antibody</p>

<p>TLR5 antibody was raised using the N terminal of TLR5 corresponding to a region with amino acids QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH</p>

<p>ICAM1 antibody was raised in Mouse using a purified recombinant fragment of human ICAM1(28-480aa) expressed in E. coli as the immunogen.</p>

<p>The CD56 antibody is a monoclonal antibody that specifically targets CD56, a cell adhesion molecule found on the surface of various cell types. It is used in Life Sciences research and diagnostics to detect and analyze CD56 expression. This antibody has also been shown to have potential therapeutic applications, particularly in the treatment of certain cancers.</p>

<p>DDI1 antibody was raised in Rabbit using Human DDI1 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Through various metabolic transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this active form of the drug is metabolized in the body. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside has been shown to bind to markers expressed in Mycobacterium tuberculosis strains and inhibit cell growth in culture.</p>

<p>Rabbit polyclonal cJun antibody (Thr93)</p>

<p>MRPS2 antibody was raised using the N terminal of MRPS2 corresponding to a region with amino acids MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR</p>

<p>Mouse monoclonal Toll-like receptor 2 antibody (biotin)</p>

<p>SPINT1 antibody was raised using the middle region of SPINT1 corresponding to a region with amino acids PFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPS</p>

<p>Rabbit polyclonal PAK4/5/6 antibody</p>

<p>GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD</p>

<p>Purified recombinant CARD17 protein (His tag)</p>

<p>The IL21R protein is a monoclonal antibody that targets the epidermal growth factor (EGF) and belongs to the class of conjugated proteins. It has an EGF-like structure and exhibits cytotoxic and neutralizing effects against tumor necrosis factor-alpha (TNF-α). IL21R protein has been shown to be effective in combination with other therapies, such as adalimumab, for the treatment of various diseases. It can also be used in research and diagnostic applications, as it is a valuable tool for studying cellular signaling pathways and biomarkers. Additionally, IL21R protein has potential applications in gene therapy, as it can be delivered using adeno-associated viruses or incorporated into DNA vaccines. With its ability to modulate growth factors like TGF-beta, this protein holds promise in the field of life sciences for enhancing biomass production and promoting tissue regeneration.</p>

<p>TIMP1 protein is an inhibitory factor that plays a crucial role in various biological processes. It is widely used in the field of Life Sciences as a research tool and has applications in Proteins and Antigens studies. TIMP1 protein has been shown to be activated by adalimumab, a monoclonal antibody, and has neutralizing effects on TNF-α, a pro-inflammatory cytokine. Additionally, TIMP1 protein is involved in regulating collagen metabolism and angiogenesis through its interaction with angptl3. It can be used in electrode-based assays or as an antigenic peptide for the development of DNA vaccines or monoclonal antibodies. With its diverse applications and versatility, TIMP1 protein is an essential component in many research projects.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UCHL5 antibody, catalog no. 70R-3208</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of B3GALT6 antibody, catalog no. 70R-7242</p>

<p>ZNF468 antibody was raised in rabbit using the middle region of ZNF468 as the immunogen</p>

<p>CFP antibody was raised using the N terminal of CFP corresponding to a region with amino acids QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS</p>

<p>Pnrc2 antibody was raised in rabbit using the N terminal of Pnrc2 as the immunogen</p>

<p>Perforin antibody was raised in mouse using purified granules from human YT lymphoma cell line as the immunogen.</p>

<p>Rabbit anti-guinea pig IgG (H+L) (FITC) was raised in rabbit using guinea pig IgG whole molecule as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GLYAT antibody, catalog no. 70R-2467</p>

<p>NUP62 antibody was raised using the N terminal of NUP62 corresponding to a region with amino acids SGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD10 antibody, catalog no. 70R-1503</p>

<p>The PEA15 antibody is a polyclonal antibody that specifically targets interleukin-6 (IL-6), an inflammatory cytokine involved in various physiological processes. This antibody acts as an inhibitory factor for IL-6, preventing its activation and downstream signaling pathways. Additionally, the PEA15 antibody has been shown to have neutralizing effects on other proteins, such as epidermal growth factor (EGF) and glycine.</p>

<p>ESR1 antibody was raised in rabbit using the C terminal of ESR1 as the immunogen</p>

<p>M-Methyl atomoxetine hydrochloride is a chemical compound, classified as a pharmaceutical intermediate or research chemical. It is synthesized from atomoxetine, a selective norepinephrine reuptake inhibitor (NRI). The compound functions by inhibiting the transporter responsible for the reabsorption of norepinephrine, thus increasing its availability in the synaptic cleft.</p>

<p>FASTKD2 antibody was raised using the middle region of FASTKD2 corresponding to a region with amino acids DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR</p>

<p>CRH antibody was raised in Rabbit using Human CRH as the immunogen</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Rabbit polyclonal TUSC4 antibody</p>

<p>DTX2 antibody was raised in Rabbit using Human DTX2 as the immunogen</p>

<p>DPP9 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The BRaf antibody is a highly specific antibody used in various life science applications. It is commonly used to detect and measure the levels of BRaf protein in samples. This antibody has been extensively validated and shown to have high affinity and specificity for BRaf.</p>

<p>Purified recombinant Human RGS19 protein</p>

<p>The IRAK1 antibody is a high-quality polyclonal antibody that specifically targets and binds to interleukin-1 receptor-associated kinase 1 (IRAK1). This antibody is crucial in life sciences research as it plays a vital role in the innate immune response. It has been extensively used to study the signaling pathways involved in inflammatory responses and autoimmune diseases.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDE1C antibody, catalog no. 70R-2073</p>

<p>Collagen Type II protein is a vital component of connective tissues, providing strength and support to various structures in the body. It plays a crucial role in maintaining healthy joints and cartilage. This protein has been extensively studied for its potential therapeutic applications.</p>

<p>The Progesterone Receptor antibody is a polyclonal antibody that is used in life sciences research. It specifically targets the progesterone receptor, a protein involved in various physiological processes. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) activity, which makes it useful for studying angiogenesis and tumor growth. In addition, it has been used to detect the presence of the progesterone receptor in various cell types, including MCF-7 breast cancer cells. The Progesterone Receptor antibody is activated by binding to its target protein and can be used in a variety of assays, such as ELISA or immunohistochemistry. Its high specificity and affinity make it an essential tool for researchers studying hormone signaling pathways and related diseases.</p>

<p>Rat monoclonal CD4 antibody (PE); mouse target; IgG2b kappa; clone GK1.5</p>

<p>ATP5B antibody was raised using the C terminal of ATP5B corresponding to a region with amino acids MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEH</p>

<p>1-453 amino acids: MGSSHHHHHH SSGLVPRGSH MSKISEAVKR ARAAFSSGRT RPLQFRIQQL EALQRLIQEQ EQELVGALAA DLHKNEWNAY YEEVVYVLEE IEYMIQKLPE WAADEPVEKT PQTQQDELYI HSEPLGVVLV IGTWNYPFNL TIQPMVGAIA AGNAVVLKPS ELSENMASLL ATIIPQYLDK DLYPVINGGV PETTELLKER FDHILYTGST GVGKIIMTAA AKHLTPVTLE LGGKSPCYVD KNCDLDVACR RIAWGKFMNS GQTCVAPDYI LCDPSIQNQI VEKLKKSLKE FYGEDAKKSR DYGRIISARH FQRVMGLIEG QKVAYGGTGD AATRYIAPTI LTDVDPQSPV MQEEIFGPVL PIVCVRSLEE AIQFINQREK PLALYMFSSN DKVIKKMIAE TSSGGVAAND VIVHITLHSL PFGGVGNSGM GSYHGKKSFE TFSHRRSCLV RPLMNDEGLK VRYPPSPAKM TQH</p>

<p>LIN7C antibody was raised in Rabbit using Human LIN7C as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NECAB3 antibody, catalog no. 70R-3494</p>

<p>Il36a protein is a growth factor that belongs to the family of chemokines. It plays a crucial role in various biological processes, including the regulation of immune responses and inflammation. Il36a protein is involved in the activation of dopamine receptors and has been shown to have atypical hemolytic effects on endothelial cells. This protein can be detected using monoclonal antibodies in human serum samples. Il36a protein also interacts with other proteins, such as phosphorylcholine and TNF-α, and may play a role in the regulation of growth hormone receptor activity. Its conjugated form has been studied extensively in life sciences research for its potential therapeutic applications.</p>

<p>The GluR1 antibody is a monoclonal antibody that specifically targets the GluR1 subunit of the glutamate receptor. It has been shown to be effective in various research applications, including neuroscience and neurobiology studies. The GluR1 antibody can be used to investigate the role of GluR1 in synaptic plasticity, learning and memory, and neuronal development.</p>

<p>EPCAM antibody was raised in Rabbit using Human EPCAM as the immunogen</p>

<p>Recombinant human TRPT1 protein (His tag)</p>

<p>The Norovirus G2 antibody is a highly effective and specific monoclonal antibody that is widely used in immunoassays in the field of Life Sciences. This antibody has neutralizing properties, making it an essential tool for researchers studying norovirus infections. It targets the tyrosine kinase receptor on norovirus particles, preventing their attachment to host cells and subsequent infection.</p>

<p>EFNA3 antibody was raised in Rabbit using Human EFNA3 as the immunogen</p>

<p>SF4 antibody was raised using the middle region of SF4 corresponding to a region with amino acids TFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIK</p>

<p>The Cyp8b1 antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets and detects the Cyp8b1 protein. This protein plays a crucial role in various cellular processes, including the metabolism of imatinib, activation of p38 MAPK pathway, and regulation of extracellular histones.</p>

<p>Rabbit polyclonal CRGF antibody (FITC)</p>

<p>NRIP3 antibody was raised in rabbit using the middle region of NRIP3 as the immunogen</p>

<p>Rabbit Polyclonal Cyclin B1 antibody (Ser147)</p>

<p>GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ</p>

<p>Purified Polyclonal HCCS antibody</p>

<p>Rabbit polyclonal NFKB1 antibody (HRP)</p>

<p>Affinity purified Rabbit polyclonal Cytokeratin 2 antibody</p>

<p>MDM4 antibody was raised in rabbit using the N terminal of MDM4 as the immunogen</p>

<p>Transferrin antibody (Texas Red) was raised in rabbit using human transferrin as the immunogen.</p>

<p>Mouse monoclonal CD4 antibody (FITC); human immunogen; IgG1 kappa; clone RPA-T4</p>

<p>Rabbit polyclonal PDSS2 antibody</p>

<p>Purified Polyclonal Frizzled 6 antibody</p>

<p>Rabbit polyclonal CAF1A antibody</p>

<p>Purified Polyclonal NCKX2 antibody</p>

<p>DOK2 antibody was raised in rabbit using the C terminal of DOK2 as the immunogen</p>

<p>Purified Rabbit polyclonal MADS50 antibody</p>

<p>ZNF431 antibody was raised in rabbit using the N terminal of ZNF431 as the immunogen</p>

<p>Purified Polyclonal Complement C1R LC antibody</p>

<p>The CD80 antibody is a collagen-based monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to the CD80 protein, which is an important immune checkpoint molecule involved in T-cell activation. The antibody has been shown to effectively block the interaction between CD80 and its receptor, leading to the inhibition of T-cell activation and proliferation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of INSIG2 antibody, catalog no. 70R-6929</p>

<p>Rabbit Polyclonal p53 antibody (Ser315)</p>

<p>Purified Polyclonal SHCB antibody</p>

<p>Rabbit polyclonal SCUBE3 antibody</p>

<p>CA2 antibody was raised in Rabbit using Human CA2 as the immunogen</p>

<p>Rabbit Polyclonal POU2F1 antibody (Ser385)</p>

<p>The Keratin 8 antibody is a disulfide bond-based polyclonal antibody that specifically targets and detects the presence of Keratin 8. This antibody is commonly used in life sciences research, particularly in studies involving cell biology and molecular biology. It can be used for various applications such as immunohistochemistry, western blotting, and ELISA.</p>

<p>Methamphetamine antibody was raised in mouse using methamphetamine (phenyl ring para position) as the immunogen.</p>

<p>Rabbit polyclonal TRADD antibody</p>

<p>HNRPM antibody was raised using the N terminal Of Hnrpm corresponding to a region with amino acids ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TSPAN6 antibody, catalog no. 70R-5977</p>

<p>Enkephalin antibody was raised in rabbit using synthetic met-enkephalin (Sigma) conjugated toBSA as the immunogen.</p>

<p>CD40 antibody (Azide free) was raised in rat using CD40 as the immunogen</p>

<p>14:0 Pc-d63 is a ligand that binds to the receptor site of GABA-A receptors. It has been shown to be an activator of this receptor, which may be due to its ability to bind and activate the ion channels in these receptors. 14:0 Pc-d63 can also bind to other proteins, inhibiting their activity. This ligand has been used as a research tool in cell biology, peptide chemistry, and antibody development.</p>

<p>CDC26 antibody was raised in rabbit using the C terminal of CDC26 as the immunogen</p>

<p>Rabbit Polyclonal OR8I2 antibody</p>

<p>LUF7244 is a pharmaceutical agent, which is a synthetic compound derived from rational drug design. Its primary source is laboratory synthesis utilizing advanced organic chemistry techniques. The mode of action of LUF7244 involves selective antagonism of specific receptor subtypes, allowing for precise modulation of receptor activity. This antagonistic behavior is achieved through competitive binding at the receptor site, inhibiting the natural ligand interaction and subsequent signaling pathways.</p>

<p>KCNH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH</p>

<p>Keratin K10 antibody was raised in Guinea Pig using synthetic peptide of human keratin K10 coupled to KLH as the immunogen.</p>

<p>Rabbit polyclonal Dab1 antibody</p>

<p>Purified recombinant p15 Treponema Pallidum protein</p>

<p>Junctophilin 1 antibody was raised using the C terminal of JPH1 corresponding to a region with amino acids KESKAEPKAKKSELAIPKNPASNDSCPALEKEANSGPNSIMIVLVMLLNI</p>

<p>Tropomyosin protein is a lipoprotein lipase that plays a crucial role in various cellular processes. It is involved in the regulation of lipase activity and has been found to be associated with the development of certain diseases, such as breast cancer. Tropomyosin protein has been studied extensively in the field of Life Sciences and has shown potential as a target for therapeutic interventions. Monoclonal antibodies against tropomyosin protein have been developed and have demonstrated neutralizing effects on its activity. These antibodies can be used in research and diagnostic applications to study antigen-antibody reactions and to detect tropomyosin protein levels in biological samples. The availability of native proteins and antigens allows for accurate and reliable measurements, contributing to advancements in the understanding of this important biomolecule.</p>

<p>The PRDX1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to PRDX1, a protein involved in various cellular processes. This antibody has been shown to inhibit collagen production and the activity of certain enzymes, making it a potential therapeutic option for conditions related to collagen disorders and enzyme dysregulation. Additionally, the PRDX1 antibody has cytotoxic properties, meaning it can induce cell death in specific cell types. It can also be used as a tool in laboratory experiments to detect and quantify PRDX1 levels in samples. With its ability to target PRDX1 and modulate its function, this antibody holds promise for developing novel treatments and understanding the role of PRDX1 in different biological pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of APEH antibody, catalog no. 70R-2582</p>

<p>Purified recombinant Human RAB21 protein</p>

<p>Purified recombinant Human PSMB9 protein</p>

<p>Purified Polyclonal OCRL antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STX19 antibody, catalog no. 70R-3408</p>

<p>SLC7A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPF</p>

<p>Affinity purified Rabbit polyclonal GPR137B antibody</p>

<p>Purified Polyclonal TBX22 antibody</p>

<p>This antibody reacts with heavy chains on hamster IgG and light chains on all hamster immunoglobulins.</p>

<p>Mouse monoclonal Tn antigen antibody (Prediluted for IHC)</p>

<p>ITGA3 antibody was raised in Rabbit using Human ITGA3 as the immunogen</p>

<p>Rabbit polyclonal CDH9 antibody</p>

<p>Pig IgM is a chimeric protein that belongs to the family of immunoglobulins. It is a monoclonal antibody that has been purified and is used in Life Sciences research. Pig IgM specifically targets amyloid plaques, which are abnormal protein deposits found in various diseases, such as Alzheimer's disease. This antibody-drug complex can be used for the detection and quantification of amyloid plaques in brain tissue samples. Pig IgM has high affinity and specificity for the target antigen, making it an ideal tool for researchers studying amyloid-related disorders. Additionally, this antibody can be used in immunoassays to measure the levels of brain natriuretic peptide (BNP), a hormone involved in regulating blood pressure and fluid balance, in human serum samples. The use of Pig IgM in these assays ensures accurate and reliable results due to its high sensitivity and low background interference.</p>

<p>RIOK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HGLEFLFRDCRNVSQFFQKGGVKEALSERELFNAVSGLNITADNEADFLA</p>

<p>Mouse monoclonal DNAJB2 antibody</p>

<p>JUP antibody was raised in Rabbit using Human JUP as the immunogen</p>

<p>Purified recombinant TDG protein (His tag)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, which prevents transcription and replication. With its high frequency of human activity, it has been extensively studied using the patch-clamp technique on human erythrocytes. Additionally, this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>RSV antibody was raised in rabbit using residues 201-211 [KQLLPIVNKQSC] of the 63 kDa RSV F protein as the immunogen.</p>

<p>Rabbit polyclonal ATXN1 antibody (Ser776)</p>

<p>C8ORF34 antibody was raised using the N terminal Of C8Orf34 corresponding to a region with amino acids MTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESK</p>

<p>Mouse monoclonal HA1C antibody</p>

<p>CIB4 antibody was raised in Rabbit using Human CIB4 as the immunogen</p>

<p>Region of MIA2 protein corresponding to amino acids MLESTKLLAD LKKCGDLECE ALINRVSAMR DYRGPDCRYL NFTKGEEISV YVKLAGERED LWAGSKGKEF GYFPRDAVQI EEVFISEEIQ MSTKESDFLC L.</p>

<p>CD4 antibody (PE) was raised in mouse using chicken CD4 as the immunogen</p>

<p>The CD4 antibody is a monoclonal antibody that specifically targets the CD4 antigen. This antibody is widely used in life sciences research to study the role of CD4 in various biological processes. The CD4 antigen is a glycoprotein found on the surface of T-helper cells, and it plays a crucial role in immune system regulation.</p>

<p>The Cyclin H antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It has been extensively tested and validated for its performance in various applications. This antibody is designed to target the cyclin H protein, which plays a crucial role in cell cycle regulation and growth factor signaling pathways.</p>

<p>The Canine Coronavirus protein is a protein complex that is found in human serum. It is used in the field of Life Sciences for various purposes, including research and diagnostics. This protein complex can be used as a tool to study the interaction between viruses and host cells, as well as to develop inhibitors and monoclonal antibodies for therapeutic use. The Canine Coronavirus protein has also been shown to have viscosity-enhancing properties, which makes it useful in applications such as the measurement of creatine kinase levels in blood samples. Additionally, this protein complex can be used as a growth factor and has been found to form dimers with other proteins such as chemokines and interleukin-6. Overall, the Canine Coronavirus protein is a versatile tool that plays a crucial role in understanding and advancing our knowledge in the field of Life Sciences.</p>

<p>PPP1R13L antibody was raised in mouse using recombinant Human Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 13 Like (Ppp1R13L)</p>

<p>Rabbit polyclonal PGM2L1 antibody</p>

<p>MMD2 antibody was raised using the N terminal of MMD2 corresponding to a region with amino acids FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL</p>

<p>RUNX3 antibody was raised in rabbit using the C terminal of RUNX3 as the immunogen</p>

<p>MCART6 antibody was raised using the middle region of MCART6 corresponding to a region with amino acids WPVLARNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSVNGTITCLV</p>

<p>Rabbit polyclonal PTK6 antibody</p>

<p>Mouse monoclonal PRS3 antibody</p>

<p>IL11R alpha antibody was raised using the middle region of IL11RA corresponding to a region with amino acids FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALS2CR12 antibody, catalog no. 70R-3279</p>

<p>The ITGB4 antibody is a highly specialized biomolecule that acts as an inhibitor of growth factors. It specifically targets nuclear and nucleotide molecules, preventing them from activating certain cellular processes. This monoclonal antibody has been shown to have a high affinity for the tyrosine residues on the surface of cells, effectively blocking their interaction with growth factor receptors.</p>

<p>ERCC5 antibody was raised in Rabbit using Human ERCC5 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR2D3 antibody, catalog no. 70R-9860</p>

<p>Rabbit polyclonal AQP12 antibody</p>

<p>Mouse monoclonal RXRG antibody</p>

<p>FXYD5 antibody was raised using the middle region of FXYD5 corresponding to a region with amino acids DETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPST</p>

<p>Mouse monoclonal PPARA antibody</p>

<p>CYP27A1 antibody was raised in Rabbit using Human CYP27A1 as the immunogen</p>