Biochemicals and Reagents

<p>PCDHB15 antibody was raised using the N terminal of PCDHB15 corresponding to a region with amino acids VMEETERGSFVANLANDLGLGVGELAERGARVVSEDNEQGLQLDLQTGQL</p>

<p>Donkey anti-mouse IgG (H + L) (Fab'2) (HRP) was raised in donkey using murine IgG (H&amp;L) as the immunogen.</p>

<p>Purified Polyclonal CT47 antibody</p>

<p>SARS E2 antibody was raised in Mouse using a purified recombinant fragment of SARS-E2 glycoprotein precursor expressed in E. coli as the immunogen.</p>

<p>FKHR antibody is a highly specialized antibody used in Life Sciences research. It is a polyclonal antibody that specifically targets the FKHR protein, which plays a crucial role in various cellular processes. This antibody can be used in bioassays to study the function and localization of FKHR within cells.</p>

<p>Rabbit polyclonal TRADD antibody</p>

<p>The CD24 antibody is a highly specialized product in the field of Life Sciences. It is an activated chemokine antibody that plays a crucial role in various biological processes. This antibody specifically targets CD24, a cell surface protein involved in cell adhesion and signaling.</p>

<p>Purified Polyclonal UBE2A/B antibody</p>

<p>Mouse IgG (H + L) purified protein</p>

<p>Mouse monoclonal EMA antibody (biotin conjugated)</p>

<p>Cytokeratin 5 antibody is a monoclonal antibody that specifically targets the Cytokeratin 5 protein. This protein is found in various tissues and is commonly used as a marker for epithelial cells. The antibody recognizes specific epitopes on the Cytokeratin 5 protein, allowing for its detection and localization in samples.</p>

<p>BMPR2 antibody was raised in Rabbit using Human BMPR2 as the immunogen</p>

<p>CDC5L antibody was raised using a synthetic peptide corresponding to a region with amino acids LHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDE</p>

<p>Purified recombinant LECT1 protein (His tag)</p>

<p>Rabbit polyclonal ZAP70 antibody (Tyr292)</p>

<p>Rabbit polyclonal TIF1 beta antibody</p>

<p>CD20 antibody was raised in Mouse using synthetic peptide corresponding to aa (EPANPSEKNSPSTQY) of human CD20, conjugated to KLH, as the immunogen.</p>

<p>MCM10 antibody was raised using the middle region of MCM10 corresponding to a region with amino acids PKLSALAEAKKLAAITKLRAKGQVLTKTNPNSIKKKQKDPQDILEVKERV</p>

<p>FSD1L antibody was raised in rabbit using the C terminal of FSD1L as the immunogen</p>

<p>The APOA1 protein is a type 1 interferon that plays a crucial role in lipid metabolism and cardiovascular health. It acts as a carrier for cholesterol and other lipids, facilitating their transport through the bloodstream. APOA1 also has anti-inflammatory properties and is involved in the regulation of immune responses.</p>

<p>Purified recombinant RPS13 protein (His tag)</p>

<p>GOPC antibody was raised using the middle region of GOPC corresponding to a region with amino acids RNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKE</p>

<p>ICMT antibody was raised using the middle region of ICMT corresponding to a region with amino acids GSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPI</p>

<p>Rabbit polyclonal SELS antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WDR4 antibody, catalog no. 70R-2223</p>

<p>Rabbit anti-goat IgG (H + L) (FITC) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>

<p>ZNF233 antibody was raised in rabbit using the middle region of ZNF233 as the immunogen</p>

<p>Rabbit polyclonal Alpha enolase antibody (FITC)</p>

<p>KCNJ1 antibody was raised using the middle region of KCNJ1 corresponding to a region with amino acids LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PITPNM1 antibody, catalog no. 70R-9888</p>

<p>Rat monoclonal CD5 antibody (allophycocyanin)</p>

<p>Goat polyclonal R Phycoerythrin antibody</p>

<p>The STAT5A antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the STAT5A protein, which plays a crucial role in cellular signaling pathways. This antibody can be used for various applications, including Western blotting, immunoprecipitation, and immunofluorescence.</p>

<p>Purified Rabbit polyclonal NDUFA4 antibody</p>

<p>The ARHGDIB antibody is a glycoprotein that belongs to the class of monoclonal antibodies. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets e-cadherin expression and has been proven to be an effective inhibitor in studies. The ARHGDIB antibody is available in a colloidal form, making it easy to use and highly efficient. It can be used as a powerful tool for researchers and scientists working in the field of nuclear and biochemical studies. With its activated properties, this monoclonal antibody holds great potential as a medicament for targeted therapies.</p>

<p>Rabbit polyclonal SSSCA1 antibody</p>

<p>HOX-C13 antibody was raised in Guinea Pig using synthetic human Hox C13 peptide as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RP11-35F15.2 antibody, catalog no. 70R-6714</p>

<p>Rabbit polyclonal SKIV2L2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPOPL antibody, catalog no. 70R-8869</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBBP7 antibody, catalog no. 70R-2124</p>

<p>ZNHIT1 antibody was raised in rabbit using the N terminal of ZNHIT1 as the immunogen</p>

<p>The beta Amyloid antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the amyloid protein, which is associated with various neurodegenerative disorders such as Alzheimer's disease. This antibody has been extensively tested and validated for use in immunoassays, making it an essential component in research and diagnostic applications.</p>

<p>Claudin 15 antibody was raised using the middle region of CLDN15 corresponding to a region with amino acids LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA</p>

<p>Affinity purified Rabbit polyclonal ARHGAP4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OGDH antibody, catalog no. 70R-3029</p>

<p>Rabbit polyclonal RLBP1L2 antibody</p>

<p>1-199 amino acids: MGSSHHHHHH SSGLVPRGSH MEARDKQVLR SLRLELGAEV LVEGLVLQYL YQEGILTENH IQEINAQTTG LRKTMLMLDI LPSRGPKAFD TFLDSLQEFP WVREKLKKAR EEAMTDLPAG DRLTGIPSHI LNSSPSDRQI NQLAQRLGPE WEPMVLSLGL SQTDIYRCKA NHPHNVQSQV VEAFIRWRQR FGKQATFQSL HNGLRAVEVD PSLLLHMLE</p>

<p>EPO antibody was raised using the middle region of EPO corresponding to a region with amino acids  KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD</p>

<p>Recombinant Human KLF12 protein</p>

<p>Mouse monoclonal LCMT1 antibody</p>

<p>Purified Polyclonal PPP2R5A antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IL10RA antibody, catalog no. 70R-1865</p>

<p>Rabbit anti-guinea pig IgG (H+L) (Rhodamine) was raised in rabbit using guinea pig IgG whole molecule as the immunogen.</p>

<p>Rabbit polyclonal STRN antibody</p>

<p>ZNF276 antibody was raised in rabbit using the middle region of ZNF276 as the immunogen</p>

<p>Mouse monoclonal CD23 antibody (PE)</p>

<p>Rabbit polyclonal SERPINA5 antibody</p>

<p>The CtBP1 antibody is a highly specialized monoclonal antibody that targets the CtBP1 protein. This protein plays a crucial role in various cellular processes, including cell adhesion and gene regulation. The CtBP1 antibody specifically recognizes and binds to CtBP1, allowing for its detection and analysis in various biological samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLDN antibody, catalog no. 70R-2858</p>

<p>TNF alpha antibody was raised in mouse using highly pure recombinant human TNF-alpha as the immunogen.</p>

<p>The CD144 antibody is a highly specialized monoclonal antibody that targets the CD144 protein, also known as vascular endothelial cadherin (VE-cadherin). This human protein plays a crucial role in maintaining the integrity and stability of endothelial cells, which line the inner walls of blood vessels. The CD144 antibody is derived from a hybridoma cell line, resulting in a specific and potent antibody with high affinity for CD144.</p>

<p>Thrombin-Antithrombin III Matched Pair antibody Set for ELISA</p>

<p>The GATA4 antibody is a polyclonal antibody used in life sciences research. It specifically targets the GATA4 protein, which plays a crucial role in various biological processes. This antibody can be used in experiments to study the interaction of GATA4 with other proteins and its involvement in gene regulation.</p>

<p>The Aprotinin antibody is a powerful tool in the field of Life Sciences. This antibody exhibits potent antioxidant and anti-inflammatory properties, making it a valuable asset for research and therapeutic applications. It acts as an inhibitor, targeting specific molecules involved in inflammatory processes. In in-vitro cultures, the Aprotinin antibody has been shown to effectively neutralize coumestrol-induced oxidative stress and exhibit strong antioxidant activity. Additionally, it has been found to enhance antioxidative activity in granulosa cells. With its ability to inhibit tissue plasminogen activation at neutral pH, this monoclonal antibody is an indispensable tool for studying various biological processes and developing novel treatments.</p>

<p>CK1 delta antibody was raised using the middle region of CSNK1D corresponding to a region with amino acids NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TUBA3C antibody, catalog no. 70R-2135</p>

<p>Goat anti-human IgG (H+L) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal Glypican 5 antibody</p>

<p>HIV1 p24 antibody (HRP) was raised in goat using purified native p24 from strain IIIB as the immunogen.</p>

<p>ECHS1 antibody was raised using the C terminal of ECHS1 corresponding to a region with amino acids KESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ</p>

<p>Purified Polyclonal Caspase 10 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRT16 antibody, catalog no. 70R-2869</p>

<p>IL10 antibody is a highly specialized monoclonal antibody that targets the protein interleukin-10 (IL-10). IL-10 is an important anti-inflammatory cytokine that plays a crucial role in regulating immune responses. This antibody specifically binds to IL-10, preventing its interaction with its receptors and inhibiting its biological activity.</p>

<p>Rabbit polyclonal PKIB antibody</p>

<p>Please enquire for more information about (S)-Viloxazine-d5 hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (±)7(8)-Epdote including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about R-(-)-Manidipine-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ent-calindol-13C,d2 hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(-)-Corynantheidine is a tylosin analog that has been found to exhibit potent anticancer activity. It is a kinase inhibitor that can induce apoptosis in various types of cancer cells, including human tumor cells. (-)-Corynantheidine has been shown to inhibit the activity of several kinases, including those involved in cell growth and division. This compound also exhibits anti-inflammatory properties and can reduce the production of pro-inflammatory cytokines. Additionally, (-)-Corynantheidine has menthol-like properties and can be detected in urine samples. Its potential as an anticancer agent makes it a promising candidate for further research and development of cancer treatments.</p>

<p>Prostaglandin F1α-d9 is an analog of prostaglandin that has been shown to have potent anticancer properties. It acts as an inhibitor of tumor growth by inhibiting the activity of cyclin-dependent kinases, which are essential for cell division and proliferation. Prostaglandin F1α-d9 induces apoptosis in cancer cells, leading to their death. This compound has been tested in Chinese hamster ovary cells and human cancer cell lines, where it demonstrated significant inhibition of protein kinase activity. Prostaglandin F1α-d9 is excreted in urine and may be a useful biomarker for measuring the effectiveness of cancer treatments. Its potential as an anticancer drug makes it a promising candidate for further research into cancer therapy.</p>

<p>Please enquire for more information about Ent-alvimopan including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 17-Trifluoromethylphenyl trinor prostaglandin f2α methyl ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dehydro ivabradine-d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fumaric acid-13C4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1-Myristoyl-3-palmitoyl-rac-glycerol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>BE 52440a is an analog that has shown promising results as an anticancer agent. It works by inhibiting protein kinases, which are enzymes that play a key role in cancer cell growth and survival. BE 52440a has been found to induce apoptosis (programmed cell death) in human cancer cells, making it a potential candidate for cancer therapy. This inhibitor has also demonstrated potent activity against Chinese hamster ovary cells and has been shown to inhibit luciferase activity in vitro. BE 52440a is available in urine form and can be administered via injection or oral route with the help of mannitol.</p>

<p>Please enquire for more information about (R)-Darifenacin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>8-Azaguanosine is a potent inhibitor of kinases that has been shown to have anticancer properties. It can be found in urine and is known to inhibit protein synthesis, leading to apoptosis in human cancer cells. This compound has also been studied as an analog of saxagliptin, a diabetes medication that inhibits dipeptidyl peptidase-4 (DPP-4) enzymes. 8-Azaguanosine has been found to be a potent inhibitor of DPP-4, which may contribute to its anticancer effects by blocking the degradation of incretin hormones. In Chinese hamster ovary cells, this compound has been shown to induce tumor cell death and inhibit cell proliferation. Its potential as a cancer treatment makes it an important area of research for future drug development.</p>

<p>Handle region peptide, rat is a biomolecule that has various applications in the field of Life Sciences. It is derived from the handle region of a specific protein and has been studied for its potential cytotoxic effects on mcf-7 cells. In addition, this peptide has shown promise as an antiviral agent through molecular docking studies. Handle region peptide, rat has also been investigated for its ability to inhibit certain enzymes and interact with other molecules such as propionate, adenine, mometasone, and ketamine. Its unique properties make it a valuable tool for researchers in the biomedical field.</p>

<p>Please enquire for more information about Glibenclamide potassium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about α-Chloro imazamox including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cilomilast-d9 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tibi is a protein inhibitor that has shown promising results in the treatment of cancer. This inhibitor specifically targets cancer cells and induces apoptosis, or programmed cell death, in these cells. Tibi has been shown to be effective against a variety of human cancer cell lines, including leukemia. The mechanism of action for Tibi involves inhibition of cyclin-dependent kinases, which play a critical role in regulating the cell cycle. By inhibiting these kinases, Tibi disrupts the normal progression of the cell cycle in cancer cells and ultimately leads to their death. This anticancer agent holds great potential as a therapeutic option for those suffering from various types of tumors.</p>

<p>TSPC is a potent inhibitor of protein kinase that exhibits antibacterial activity and has been shown to inhibit cell growth in human epithelial and endothelial cells. TSPC has also demonstrated antitumor activity by inducing cell death and inhibiting cell proliferation. It has been found to be effective against Escherichia coli, as well as other bacterial strains. TSPC works by inhibiting the activity of protein kinases, which are enzymes that regulate various cellular processes such as the cell cycle and protein synthesis. This inhibition leads to a disruption in cellular signaling pathways, ultimately resulting in the inhibition of cell growth and proliferation.</p>

<p>Please enquire for more information about Omeprazole-d6 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tinopal RBS 200 is a medicinal compound that has been used in Chinese traditional medicine to treat tumors. It is an analog of protein kinase inhibitors and has been shown to induce apoptosis in cancer cells. Tinopal RBS 200 inhibits the activity of kinases, which are enzymes that play a crucial role in the development and progression of cancer. This compound has shown anticancer properties in human cancer cell lines, making it a promising candidate for future cancer therapies. Tinopal RBS 200 can be detected in urine samples and may have potential as a diagnostic tool for cancer detection.</p>

<p>HBC620 is a medicinal compound derived from Chinese herbs that has been shown to be an effective inhibitor of kinases in cancer cells. It works by blocking the activity of certain proteins that are involved in cell growth and division, thereby inducing apoptosis (programmed cell death) in cancer cells. HBC620 is a potent anticancer agent and has been shown to be effective against various types of tumors in human studies. This compound is also found in urine and is structurally similar to other kinase inhibitors, making it a promising candidate for further development as a cancer treatment. Its analogs have also been studied as potential inhibitors of protein kinases, with promising results.</p>

<p>Concanamycin C is an analog of the human kinase inhibitor that has been shown to have potent anticancer activity. This compound induces apoptosis in cancer cells by inhibiting the activity of protein kinases involved in cell cycle regulation and tumor growth. Concanamycin C is a medicinal compound that has been used as a research tool in the development of novel kinase inhibitors for cancer therapy. This potent inhibitor has been shown to be effective against various types of cancer, making it a promising candidate for further investigation as an anticancer drug. Its unique properties make it an attractive target for the development of new and more effective kinase inhibitors.</p>

<p>Isomethyl-β-ionone is an analog of β-ionone, which is a natural compound found in urine. It has been shown to be a potent inhibitor of kinase activity and apoptosis in cancer cells. Isomethyl-β-ionone has anticancer properties and has been used in Chinese medicinal practices for its tumor-inhibiting effects. This compound inhibits the cell cycle and promotes apoptosis in human cancer cells, making it a promising candidate for anticancer therapy. Additionally, Isomethyl-β-ionone has been shown to have low toxicity levels, making it a safe option for cancer treatment.</p>

<p>Please enquire for more information about CDK9-IN-7 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PD-1/PD-L1-IN-10 is a medicinal protein analog that acts as an inhibitor of kinases involved in the growth and proliferation of cancer cells. It has been shown to inhibit tumor cell growth and induce apoptosis in Chinese hamster ovary cells. PD-1/PD-L1-IN-10 is a potent inhibitor of the PD-1/PD-L1 signaling pathway, which plays a critical role in the regulation of immune responses. This protein analog has been extensively studied for its potential use in cancer therapy, as it effectively blocks the binding of PD-L1 to PD-1 receptors on T cells, thereby enhancing their anti-tumor activity. PD-1/PD-L1-IN-10 is excreted primarily through urine and has shown promising results as a potential treatment for various types of cancer when used in combination with other kinase inhibitors.</p>

<p>Please enquire for more information about (+)-Cis-10-methoxyvincamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 6,6-Dimethoxy-2,2-binaphthalene including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetophenone-13C6 is a potent inhibitor of protein kinases and has shown potential as an anticancer agent. It is an analog of rifampicin, a well-known antibiotic used to treat tuberculosis. Acetophenone-13C6 has been found to induce apoptosis in human cancer cells, making it a promising candidate for cancer treatment. This compound has also been detected in the urine of Chinese cancer patients, indicating its potential as a biomarker for tumor diagnosis and monitoring. Acetophenone-13C6 inhibits the activity of various kinases involved in cancer cell proliferation and survival, making it a valuable tool for studying kinase signaling pathways and developing new kinase inhibitors.</p>

<p>Halfenprox is a medicinal compound that acts as an inhibitor of kinase proteins. It has been shown to have anticancer properties, inducing apoptosis in cancer cells and inhibiting tumor growth. This compound specifically targets human kinases, making it a promising candidate for the development of targeted cancer therapies. Halfenprox is an analog of a Chinese medicinal compound and has been found in urine samples from cancer patients undergoing treatment with this compound. Its potential as a novel anticancer agent warrants further investigation.</p>

<p>Imipramine pamoate is a kinase inhibitor that has been shown to induce apoptosis in human cancer cells. It is an analog of amphetamine and has potent anticancer activity. Imipramine pamoate works by inhibiting the activity of several kinases, including protein kinase C and mitogen-activated protein kinase (MAPK), which are involved in cell growth and survival. This drug has been found to be effective against a variety of tumors, including breast, lung, and colon cancers. Imipramine pamoate is excreted in urine and can be used as a biomarker for cancer diagnosis or monitoring.</p>

<p>4-Hydroxy ospemifene is an analog of ospemifene that has shown to have potent anticancer activity. It acts as a kinase inhibitor, preventing the activation of kinases in cancer cells and leading to apoptosis. This medicinal compound has been extensively studied for its potential use in cancer treatment, particularly in inhibiting the growth of tumors in humans and Chinese hamsters. 4-Hydroxy ospemifene has also been found in urine samples from patients with advanced cancer, indicating its potential as a biomarker for cancer diagnosis and monitoring. This inhibitor can bind to specific proteins involved in cell division and proliferation, making it a promising candidate for targeted therapies against various types of cancer.</p>

<p>Please enquire for more information about (E)-4-(4-Chloro-1,2-diphenylbut-I-en-I-yl)phenol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>SHMT-IN-2 is a potent inhibitor of SHMT kinase, which plays a vital role in cancer cell metabolism. This inhibitor has been shown to be effective against various types of tumors and cancer cells in both in vitro and in vivo studies. It works by blocking the activity of kinases that are involved in the regulation of protein synthesis, leading to apoptosis or programmed cell death in cancer cells. SHMT-IN-2 is an analog of medicinal compounds found in Chinese herbs and has been used traditionally for its anticancer properties. This inhibitor has been detected in urine samples from human subjects, indicating its potential as a diagnostic tool for cancer.</p>

<p>Please enquire for more information about 8-(1H-Benzotriazol-1-ylamino)-octanoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A 2E is an inhibitor that has shown promising results as an anticancer agent. It induces apoptosis in cancer cells and has been found in human urine. A 2E is a protein kinase inhibitor that can inhibit the activity of streptokinase, which is involved in cancer cell growth and invasion. This inhibitor has been tested on Chinese hamster ovary cells and has shown to be effective against tumor growth. A 2E is an analog of nalbuphine, which is used as a pain reliever, but this compound has shown potential for use in cancer treatment due to its ability to induce apoptosis in cancer cells.</p>

<p>Please enquire for more information about Melphalan mono-chloroethyl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-Chloro perazine-d8 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Monascuspiloin is a potent inhibitor of kinases that has been shown to have anti-cancer properties. It inhibits the activity of kinases in urine and has been shown to inhibit the growth of cancer cells in vitro. Monascuspiloin has also been found to be effective against tumors in animal models. Additionally, it has demonstrated synergistic effects with other cancer drugs such as nintedanib and apomorphine. This analog of glimepiride induces apoptosis in human cancer cells and has been used traditionally in Chinese medicine for its medicinal properties. Overall, Monascuspiloin shows great potential as an inhibitor of kinases and a promising anti-cancer agent.</p>

<p>D-Captopril is an analog of the drug captopril, which is used to treat hypertension and heart failure. This compound has been shown to have anticancer properties by inhibiting kinases that are involved in cancer cell growth and survival. D-Captopril has been found to induce apoptosis in human and Chinese hamster ovary cells. It also enhances the anticancer effects of chloroquine and artesunate, two drugs that are commonly used for cancer treatment. Additionally, D-Captopril has been shown to inhibit tumor growth in mice models. This compound is excreted via urine and may be a promising candidate for cancer therapy as a kinase inhibitor.</p>

<p>Please enquire for more information about (2S)-2-[[4-(5-Ethynyl-1H-pyrrolo[2,3-b]pyridin-3-yl)-2,3-dihydro-1H-indol-1-yl]carbonyl]-1-pyrrolidinecarbonitrile including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hydantoin-5-13C,1-15N is an anticancer drug that acts as a cyclin-dependent kinase inhibitor. It is a Chinese medicinal analog that inhibits the cell cycle and induces apoptosis in cancer cells. Hydantoin-5-13C,1-15N has been shown to be effective against various types of tumors in human trials. This drug specifically targets the protein kinases involved in cell division, thereby preventing cancer cells from multiplying and spreading throughout the body. Its unique isotopic labeling enables it to be used for metabolic studies and drug discovery research. With its potent apoptotic effects and ability to inhibit cancer cell growth, Hydantoin-5-13C,1-15N represents a promising avenue for cancer treatment.</p>

<p>Please enquire for more information about ERK-IN-3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1-Palmitoyl-d9-2-palmitoyl-sn-glycerol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 8-[(6-Iodo-1,3-benzodioxol-5-yl)sulfanyl]-9-[3-(propan-2-ylamino)propyl]purin-6-amine trihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>AK778 is a protein inhibitor that has been shown to induce apoptosis in tumor cells. It is derived from nifedipine, a calcium channel blocker used to treat hypertension and angina. AK778 has been found in Chinese urine and has been studied for its potential as an anticancer agent. This protein kinase inhibitor analog targets specific kinases involved in cancer cell growth and proliferation, making it a promising candidate for cancer treatment. Studies have shown that AK778 exhibits potent anticancer activity against human tumor cells, making it a valuable addition to the field of oncology research.</p>

<p>Please enquire for more information about Coenzyme Q10-d6 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3,4-Diaminotoluene-d6 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about dTAGV-1-NEG including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Terameprocol is an analog of ghrelin, a hormone that regulates appetite and energy balance. It is a potent inhibitor of tumor kinase activity and has been shown to inhibit the growth of cancer cells in vitro and in vivo. Terameprocol is excreted in the urine and is not metabolized by human enzymes. This inhibitor can be used as an anticancer agent due to its ability to induce apoptosis in cancer cells. Terameprocol also inhibits the activity of kinases involved in cell proliferation, making it a promising candidate for cancer therapy. The cellulose-based formulation of terameprocol allows for targeted delivery to cancer cells while minimizing toxicity to healthy tissues.</p>

<p>Please enquire for more information about RAD51-IN-1 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methanol-18O is a potent inhibitor of kinases, particularly those involved in cancer cell growth and proliferation. It has been shown to inhibit the activity of indirubin analogs in human urine, which suggests its potential as an anticancer treatment. Methanol-18O has also been found to induce apoptosis, or programmed cell death, in tumor cells. This unique compound may have promising applications in the development of novel kinase inhibitors for cancer therapy. Additionally, Chinese researchers have reported that methanol-18O may have potential as a protein kinase inhibitor for the treatment of various types of cancer.</p>

<p>Lovastatin-d3 is an analog of lovastatin, a medicinal compound that is commonly used as a cholesterol-lowering drug. Lovastatin-d3 has been shown to have potent anticancer properties, inhibiting the growth of cancer cells in vitro and in vivo. It acts as a protein kinase inhibitor, inducing apoptosis and inhibiting tumor growth by blocking the activity of kinases that are involved in cell division and proliferation. Lovastatin-d3 is also effective against Chinese hamster ovary cells and has been detected in urine samples from human subjects treated with lovastatin. This compound shows great promise as an anticancer agent and may be useful for the development of new cancer therapies.</p>