Biochemicals and Reagents

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FXR2 antibody, catalog no. 70R-4723</p>

<p>Purified Polyclonal DDX54 antibody</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>SLC25A36 antibody was raised using the N terminal of SLC25A36 corresponding to a region with amino acids SSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLG</p>

<p>This antibody reacts with heavy chains on chicken IgG (IgY) and light chains on all chicken immunoglobulins.</p>

<p>FARSB antibody was raised in Rabbit using Human FARSB as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSME2 antibody, catalog no. 70R-9402</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. This powerful compound is highly effective in treating tuberculosis infections. It works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Its bactericidal activity has been extensively studied using advanced techniques such as patch-clamp on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. It also specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Affinity purified Rabbit polyclonal Fumarate hydratase antibody</p>

<p>PRSS21 antibody was raised in rabbit using the N terminal of PRSS21 as the immunogen</p>

<p>Purified Horse IgG FITC conjugate</p>

<p>Rabbit polyclonal GTF2IRD1 antibody</p>

<p>The LCK antibody is a monoclonal antibody that targets LCK, a protein involved in T cell signaling. This antibody is commonly used in Life Sciences research to study immune responses and investigate the role of LCK in various cellular processes. It has been shown to be effective in blocking LCK activity, leading to decreased T cell activation and cytotoxicity. Additionally, the LCK antibody has potential therapeutic applications as it can be used to develop immunogenic compositions for the treatment of viral infections or autoimmune diseases. Its high specificity and affinity make it a valuable tool for scientists working in the field of immunology and drug discovery.</p>

<p>MKRN1 antibody was raised using the C terminal of MKRN1 corresponding to a region with amino acids RYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFW</p>

<p>GNGT1 antibody was raised in Rabbit using Human GNGT1 as the immunogen</p>

<p>HSP90AB1 antibody was raised in rabbit using the C terminal of HSP90AB1 as the immunogen</p>

<p>1-298 amino acids: MGSSHHHHHH SSGLVPRGSH MGPKDSAKCL HRGPQPSHWA AGDGPTQERC GPRSLGSPVL GLDTCRAWDH VDGQILGQLR PLTEEEEEEG AGATLSRGPA FPGMGSEELR LASFYDWPLT AEVPPELLAA AGFFHTGHQD KVRCFFCYGG LQSWKRGDDP WTEHAKWFPS CQFLLRSKGR DFVHSVQETH SQLLGSWDPW EEPEDAAPVA PSVPASGYPE LPTPRREVQS ESAQEPGGVS PAEAQRAWWV LEPPGARDVE AQLRRLQEER TCKVCLDRAV SIVFVPCGHL VCAECAPGLQ LCPICRAPVR SRVRTFLS</p>

<p>Purified Polyclonal RAB23 antibody</p>

<p>IL13 antibody was raised in rabbit using highly pure recombinant human IL-13 as the immunogen.</p>

<p>Purified Polyclonal PI3K p85 beta antibody</p>

<p>OTUD6A antibody was raised in rabbit using the middle region of OTUD6A as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Hoxb9 antibody, catalog no. 70R-7888</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>The VEGFR2 antibody is a highly specialized monoclonal antibody that targets vascular endothelial growth factor receptor 2 (VEGFR2). It is designed to specifically bind to this growth factor receptor and inhibit its activity. This antibody can be used in various life science research applications, including the study of angiogenesis, tumor growth, and cardiovascular development.</p>

<p>The eNOS antibody is a highly specific antibody that targets endothelial nitric oxide synthase (eNOS). It is commonly used in research and diagnostic applications to study the role of eNOS in various biological processes. This polyclonal antibody is produced by immunizing animals with purified eNOS protein, resulting in a high affinity and specificity for eNOS detection.</p>

<p>ADRB2 antibody was raised in rabbit using the middle region of ADRB2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRSS22 antibody, catalog no. 70R-3993</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1GALT1 antibody, catalog no. 70R-7429</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and heavy (mu) chains on mouse IgM and light chains on all mouse immunoglobulins.</p>

<p>KIAA0284 antibody was raised using the N terminal of KIAA0284 corresponding to a region with amino acids QLTKARKQEEDDSLSDAGTYTIETEAQDTEVEEARKMIDQVFGVLESPEL</p>

<p>Goat anti-rabbit IgG (Rhodamine) was raised in goat using rabbit IgG F(ab')2 fragment as the immunogen.</p>

<p>Purified Rabbit IgG (Fab'2) FITC conjugate</p>

<p>1-266 amino acids: MERPQPHSMP QDLSEALKEA TKEVHTQAEN AEFMRNFQKG QVTRDGFKLV MASLYHIYVA LEEEIERNKE SPVFAPVYFP EELHRKAALE QDLAFWYGPR WQEVIPYTPA MQRYVKRLHE VGRTEPELLV AHAYTRYLGD LSGGQVLKKI AQKALDLPSS GEGLAFFTFP NIASATKFKQ LYRSRMNSLE MTPAVRQRVI EEAKTAFLLN IQLFEELQEL LTHDTKDQSP SRAPGLRQRA SNKVQDSAPV ETPRGKPPLN TRSQAPLEHH HHHH</p>

<p>Purified Polyclonal cFER antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUP35 antibody, catalog no. 70R-2172</p>

<p>AMBP antibody was raised in rabbit using the N terminal of AMBP as the immunogen</p>

<p>80 nm Colloidal Gold particle suspension</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Scara3 antibody, catalog no. 70R-8675</p>

<p>Affinity purified Rabbit polyclonal FAM50A antibody</p>

<p>Purified recombinant Human GRPEL1 protein</p>

<p>Rabbit anti-human IgG was raised in rabbit using human IgG gamma heavy chain as the immunogen.</p>

<p>Rabbit polyclonal KPBB antibody</p>

<p>DGCR6L antibody was raised in Rabbit using Human DGCR6L as the immunogen</p>

<p>The GHR antibody is a highly specialized monoclonal antibody that targets the hydrogen atom in natural compounds. It is designed to specifically bind to the dpp4 enzyme, inhibiting its activity and preventing the breakdown of certain hormones. This antibody is commonly used in life sciences research to study the role of dpp4 in various biological processes, including adipose tissue metabolism and hepatocyte growth. Additionally, this antibody can be utilized as a selectable marker in polymerase chain reaction (PCR) experiments or interferon assays. With its high affinity and specificity, the GHR antibody is an invaluable tool for scientists and researchers in the field of molecular biology.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNKS1BP1 antibody, catalog no. 70R-2291</p>

<p>Recombinant human C9orf103 protein (His tag)</p>

<p>Purified recombinant Human RhoG Protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STRA6 antibody, catalog no. 70R-6616</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DLAT antibody, catalog no. 70R-2503</p>

<p>The p53 antibody is a highly effective inhibitor used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. By blocking the activity of p53, this antibody can be used to study the molecular mechanisms involved in cell cycle control, DNA repair, and apoptosis. Additionally, it has been shown to enhance the cytotoxic effects of certain chemotherapeutic agents and interferon. With its high specificity and potency, the p53 antibody is a valuable tool for studying the function of this important tumor suppressor protein.</p>

<p>Rabbit polyclonal MPT64 antibody (FITC)</p>

<p>Rabbit Polyclonal STAT1 antibody (Tyr701)</p>

<p>The SRF antibody is a polyclonal antibody that specifically targets the carboxyl terminal of the 3-kinase protein. It is commonly used in immunoassays and research studies in the field of Life Sciences. This antibody has been shown to have high specificity and sensitivity, making it an ideal choice for various applications. It can be used to detect and quantify the expression levels of β-catenin, a key protein involved in cell signaling pathways. Additionally, the SRF antibody can be utilized in phosphatase and transfer reactions, providing valuable insights into cellular processes. With its ability to target activated proteins such as anti-VEGF and natriuretic factors, this antibody offers researchers a powerful tool for investigating molecular mechanisms and potential therapeutic targets. For reliable and accurate results, consider using the SRF antibody in your experiments or assays.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RG9MTD3 antibody, catalog no. 70R-4975</p>

<p>Prekallikrein antibody was raised in sheep using human active site-blocked Kallikrein prepared from plasma as the immunogen.</p>

<p>FUCA1 antibody was raised in Rabbit using Human FUCA1 as the immunogen</p>

<p>The BAP31 antibody is a powerful tool in the field of Life Sciences. It is a multidrug antibody that targets retinoid and fibronectin, two important molecules involved in various cellular processes. This antibody has been extensively tested and proven to be highly effective in binding to these targets, making it an essential component in research and diagnostic applications.</p>

<p>Purified Rabbit polyclonal OR56A3 antibody</p>

<p>Rabbit polyclonal GPR105 antibody</p>

<p>MAVS antibody was raised in Rabbit using Human MAVS as the immunogen</p>

<p>DAZ3 antibody was raised using the middle region of DAZ3 corresponding to a region with amino acids PFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAF</p>

<p>ALS2 antibody was raised in Rabbit using Human ALS2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MARCKS antibody, catalog no. 70R-10037</p>

<p>The SOD2 antibody is a monoclonal antibody that specifically binds to the superoxide dismutase 2 (SOD2) protein. This protein plays a crucial role in protecting cells against oxidative stress by scavenging harmful superoxide radicals. The SOD2 antibody can be used in various applications, including receptor binding studies, virus surface antigen detection, and as a research tool in Life Sciences. It is highly specific and has been extensively validated for its performance.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GNA15 antibody, catalog no. 70R-5809</p>

<p>Rabbit polyclonal PSMD12 antibody</p>

<p>TMED8 antibody was raised using the middle region of TMED8 corresponding to a region with amino acids EIEEPVPAGDVERGSRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGI</p>

<p>Rabbit polyclonal GluR1 antibody (Ser849)</p>

<p>Rabbit polyclonal POMT2 antibody</p>

<p>BBS2 antibody was raised in rabbit using the middle region of BBS2 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal MIA3 antibody</p>

<p>SENP5 antibody was raised using the middle region of SENP5 corresponding to a region with amino acids LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR</p>

<p>Affinity purified Rabbit polyclonal BAIAP2L1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AP3M2 antibody, catalog no. 70R-3582</p>

<p>Affinity purified Rabbit polyclonal GAL3ST1 antibody</p>

<p>The beta Catenin antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target the beta-catenin protein, which plays a crucial role in cell adhesion and signaling pathways. This antibody has been extensively tested and proven to have high specificity and sensitivity for detecting beta-catenin in various applications.</p>

<p>The IGF-1R antibody is a highly specialized monoclonal antibody that targets the insulin-like growth factor 1 receptor (IGF-1R). This receptor plays a crucial role in cell growth, proliferation, and survival. By binding to the IGF-1R, this antibody effectively blocks the interaction between IGF-1 and its receptor, inhibiting downstream signaling pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLITRK1 antibody, catalog no. 70R-7285</p>

<p>Rabbit polyclonal HNF4 alpha antibody (Ser313)</p>

<p>CMV antibody (HRP) was raised in goat using purified virions of strain AD169 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RERG antibody, catalog no. 70R-9847</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TAF9 antibody, catalog no. 70R-8040</p>

<p>The OIP5 antibody is a highly specialized antibody that plays a crucial role in the immune response. It is an interferon-induced protein that is involved in various cellular processes, including cell growth and differentiation. The OIP5 antibody specifically targets enteroendocrine cells and has been shown to regulate their function.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYT3 antibody, catalog no. 70R-6596</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NSUN6 antibody, catalog no. 70R-4985</p>

<p>CBLL1 antibody was raised in rabbit using the C terminal of CBLL1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Taf6l antibody, catalog no. 70R-7867</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ABAT antibody, catalog no. 70R-2214</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SNAG1 antibody, catalog no. 70R-5764</p>

<p>The SNAI1 antibody is a highly specialized diagnostic agent used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and inhibits BACE1, an enzyme involved in the production of amyloid-beta peptides. These peptides are known to play a crucial role in the development of Alzheimer's disease. The SNAI1 antibody has been extensively studied and has shown promising results in neutralizing BACE1 activity, thus potentially slowing down the progression of the disease. Additionally, this antibody has low density dimers, which allows for enhanced penetration into tissues and improved therapeutic efficacy. Its unique glycosylation pattern also contributes to its stability and cytotoxicity against cancer cells. With its potential as a diagnostic tool and medicament, the SNAI1 antibody holds great promise in advancing our understanding and treatment options for various diseases related to BACE1 activity and growth factors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of VPS4B antibody, catalog no. 70R-10350</p>

<p>This antibody reacts with heavy chains on Guinea Pig IgG and light chains on all Guinea Pig immunoglobulins.</p>

<p>Rabbit polyclonal CDH24 antibody</p>

<p>Rabbit anti-goat IgG (Alk Phos) was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.</p>

<p>DHRS3 antibody was raised in Rabbit using Human DHRS3 as the immunogen</p>

<p>The Tau antibody is a highly specialized antibody used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to Tau proteins. Tau proteins play a crucial role in maintaining the structure and function of nerve cells in the brain. However, in certain neurodegenerative diseases such as Alzheimer's disease, these proteins become abnormally phosphorylated and form tangles, leading to cognitive decline.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNQ1 antibody, catalog no. 70R-1537</p>

<p>Rabbit polyclonal ELAC2 antibody</p>

<p>ARF4 antibody was raised in Rabbit using Human ARF4 as the immunogen</p>

<p>FBXO44 antibody was raised in Rabbit using Human FBXO44 as the immunogen</p>

<p>The MUC13 antibody is a highly specialized antibody that targets the tyrosine-rich region of the MUC13 protein. It is commonly used in Life Sciences research to study multidrug resistance, glycation processes, and the role of MUC13 in various cellular pathways. This antibody has been shown to interact with key proteins such as E-cadherin, circumsporozoite protein, nuclear β-catenin, and growth factors. Additionally, it has demonstrated cytotoxic activity against specific cell lines and has potential antiviral properties. The MUC13 antibody is available as both polyclonal and monoclonal antibodies, making it a versatile tool for researchers in various fields.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DHODH antibody, catalog no. 70R-6503</p>

<p>Streptavidin (PE) is a monoclonal antibody that is commonly used in Life Sciences research. It is often conjugated with other proteins and antigens for various applications. Streptavidin (PE) has a high affinity for biotin, making it an excellent tool for detecting and quantifying biotinylated molecules. This antibody can be used in a wide range of experiments, including immunofluorescence staining, flow cytometry, and enzyme-linked immunosorbent assays (ELISA). Additionally, Streptavidin (PE) has been shown to have neutralizing effects on certain growth factors and chemokines, making it a valuable tool in cell culture studies. Its reactive properties also make it useful in electrode-based assays and mitochondrial superoxide detection. With its versatility and reliability, Streptavidin (PE) is an essential component in many research laboratories worldwide.</p>

<p>ASCL4 antibody was raised in rabbit using the N terminal of ASCL4 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CATSPER2 antibody, catalog no. 70R-5069</p>

<p>5 nm Colloidal Gold particle suspension</p>

<p>Affinity purified Rabbit polyclonal UTP6 antibody</p>

<p>Purified Polyclonal PRKAR1B antibody</p>

<p>Rabbit polyclonal FAK antibody (Tyr925)</p>

<p>Thyroid Peroxidase antibody is a monoclonal antibody used in Life Sciences research. It targets the thyroid peroxidase enzyme, which plays a crucial role in thyroid hormone synthesis. This antibody can be used to study the regulation and function of thyroid peroxidase, as well as its involvement in autoimmune thyroid diseases. Additionally, Thyroid Peroxidase antibody has been shown to have growth factor-like activity and can activate various signaling pathways. It has also been found to be involved in the glycosylation of proteins, including fibrinogen. Furthermore, this antibody has potential diagnostic applications as it can detect autoantibodies against thyroid peroxidase, which are often present in patients with autoimmune thyroid disorders. Overall, Thyroid Peroxidase antibody is a valuable tool for researchers studying thyroid biology and related diseases.</p>

<p>Purified recombinant Human BCAS2 protein</p>

<p>The HNF4 alpha antibody is a highly effective reagent used in the field of Life Sciences. It has the ability to inhibit the function of hematopoietic and pluripotent stem cells, making it a valuable tool for research and therapeutic applications. This antibody can be used in immunohistochemical studies to detect the presence of HNF4 alpha protein in various tissues and cell types. It is a polyclonal antibody, meaning it recognizes multiple epitopes on the target protein, resulting in high specificity and sensitivity. With its ability to accurately detect HNF4 alpha, researchers can gain valuable insights into the role of this protein in cellular processes and disease mechanisms. Whether you are studying cytokines or pluripotent stem cells, this HNF4 alpha antibody is an essential tool for your research needs.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NLGN4X antibody, catalog no. 70R-6162</p>

<p>The GAPDH Blocking Peptide is a versatile biomolecule that can be used in various life science applications. This peptide is designed to block the binding of proteins, such as chemokines and growth factors, to GAPDH (Glyceraldehyde-3-phosphate dehydrogenase). By preventing this interaction, the peptide inhibits downstream signaling pathways and cellular processes.</p>

<p>RAB8B antibody was raised in rabbit using the C terminal of RAB8B as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exerting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its effectiveness has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, this drug specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SRP19 antibody, catalog no. 70R-4850</p>

<p>The SARS-CoV-2 Spike Antibody is a highly effective inhibitor that belongs to the family of neutralizing antibodies. It is widely used in Life Sciences for various applications, including immunogenic compositions and assays. This antibody has been proven to effectively target the spike protein of the SARS-CoV-2 virus, which plays a crucial role in viral entry into host cells. By binding to the spike protein, this antibody prevents viral attachment and fusion, thereby inhibiting viral replication and spread.</p>

<p>GLS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DAAM1 antibody, catalog no. 70R-2236</p>

<p>The HDAC5 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and binds to HDAC5, which stands for Histone Deacetylase 5. HDAC5 is an enzyme involved in the regulation of gene expression by modifying histones, which are proteins that help package DNA in cells. By binding to HDAC5, this antibody can modulate its activity and potentially impact various cellular processes.</p>

<p>Coronavirus Nucleoprotein (NP) monoclonal antibody</p>

<p>Purified Polyclonal Kir3.3 antibody</p>

<p>1-177 amino acids: MAVANSSPVN PVVFFDVSIG GQEVGRMKIE LFADVVPKTA ENFRQFCTGE FRKDGVPIGY KGSTFHRVIK DFMIQGGDFV NGDGTGVASI YRGPFADENF KLRHSAPGLL SMANSGPSTN GCQFFITCSK CDWLDGKHVV FGKIIDGLLV MRKIENVPTG PNNKPKLPVV ISQCGEM</p>

<p>The SOX17 antibody is a monoclonal antibody that specifically targets glucagon, a hormone involved in regulating blood sugar levels. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It can be used to detect and measure glucagon levels in human serum, making it a valuable tool for research and diagnostic purposes. Additionally, the SOX17 antibody has been found to have cytotoxic effects on certain cancer cells, making it a potential candidate for targeted therapy. Its high specificity and affinity for glucagon make it an ideal choice for experiments involving the detection and manipulation of this hormone. Whether you are studying the role of glucagon in diabetes or investigating its interaction with other molecules such as insulin or collagen, the SOX17 antibody is an indispensable tool that will provide reliable and accurate results.</p>

<p>Mecamylamine HCL (USP grade powder) chemical reference substance</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRDM13 antibody, catalog no. 70R-8363</p>

<p>COX5B antibody was raised in Rabbit using Human COX5B as the immunogen</p>

<p>IP10 antibody was raised in rabbit using highly pure recombinant rat IP-10 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF233 antibody, catalog no. 70R-8164</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRTAP11-1 antibody, catalog no. 70R-3239</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GSTK1 antibody, catalog no. 70R-4024</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ERLIN1 antibody, catalog no. 70R-7393</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF121 antibody, catalog no. 70R-6550</p>

<p>The TFEB antibody is a highly specialized product in the field of Life Sciences. It is designed to specifically bind to the TFEB receptor, which plays a crucial role in various cellular processes such as glucagon signaling and collagen synthesis. This antibody is widely used in research laboratories for studying the function and regulation of TFEB.</p>

<p>MRPS36 antibody was raised in Rabbit using Human MRPS36 as the immunogen</p>

<p>CD18 antibody was raised in mouse using leucocytes from LGL-type leukemia as the immunogen.</p>

<p>Purified Polyclonal cCBL antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ERC1 antibody, catalog no. 70R-9796</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC1A2 antibody, catalog no. 70R-6543</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINE2 antibody, catalog no. 70R-5431</p>

<p>Affinity purified Rabbit polyclonal SSX2 antibody</p>

<p>The NFkB p65 antibody is a polyclonal antibody that is used for various applications in the field of Life Sciences. It is specifically designed to target and neutralize the NFkB p65 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used for techniques such as hybridization, immunoprecipitation, and immunofluorescence.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FZD6 antibody, catalog no. 70R-7308</p>

<p>Polacrilin Potassium (USP grade powder) chemical reference substance</p>

<p>Rabbit polyclonal MKL1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MMP24 antibody, catalog no. 70R-6357</p>

<p>The BAFF antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes the activity of BAFF (B-cell activating factor), a protein involved in the activation and survival of B-cells. This antibody has been extensively tested and proven to be effective in blocking the activity of BAFF, thereby preventing the proliferation and differentiation of B-cells.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POLK antibody, catalog no. 70R-5522</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP2K3 antibody, catalog no. 70R-2684</p>

<p>ALOX15B antibody was raised using the C terminal of ALOX15B corresponding to a region with amino acids ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPR</p>

<p>Purified Polyclonal CK1 alpha antibody</p>

<p>C2ORF29 antibody was raised using the middle region of C2Orf29 corresponding to a region with amino acids SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQI</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>Goat anti-bovine IgG (H + L) was raised in goat using ovine IgG (H &amp; L) as the immunogen.</p>

<p>Rabbit polyclonal GRP78 antibody (HRP)</p>

<p>Affinity purified Rabbit polyclonal MANBA antibody</p>

<p>FN3KRP antibody was raised in Rabbit using Human FN3KRP as the immunogen</p>

<p>Rabbit polyclonal RPL27 antibody (HRP)</p>

<p>Rabbit polyclonal NOL3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MGC50273 antibody, catalog no. 70R-4290</p>

<p>Isoxsuprine Conjugate for use in immunoassays</p>

<p>GATA1 antibody was raised in Rabbit using Human GATA1 as the immunogen</p>

<p>Rabbit polyclonal ZNF187 antibody</p>

<p>The IL1b antibody is a monoclonal antibody that specifically targets IL-1β, a pro-inflammatory cytokine involved in various immune and inflammatory responses. This antibody binds to IL-1β and prevents its interaction with its receptors, thereby inhibiting the downstream signaling pathways that lead to inflammation.</p>

<p>Rabbit polyclonal ADARB1 antibody</p>

<p>AP3M2 antibody was raised in Rabbit using Human AP3M2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SOX17 antibody, catalog no. 70R-8369</p>

<p>Rabbit anti-mouse IgG3 (HRP) was raised in rabbit using murine IgG3 heavy chain as the immunogen.</p>

<p>ERAL1 antibody was raised in Rabbit using Human ERAL1 as the immunogen</p>

<p>RNF121 antibody was raised using the N terminal of RNF121 corresponding to a region with amino acids WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATG</p>

<p>CARS antibody was raised using the C terminal of CARS corresponding to a region with amino acids KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4B antibody, catalog no. 70R-1418</p>

<p>VZV gE immunodominant regions containing amino acids 48-135.</p>

<p>Rabbit polyclonal IMPDH2 antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPS13 antibody, catalog no. 70R-3005</p>

<p>Region of ApoE4 protein corresponding to amino acids MKVEQAVETE PEPELRQQTE WQSGQRWELA LGRFWDYLRW VQTLSEQVQE ELLSSQVTQE LRALMDETMK ELKAYKSELE EQLTPVAEET RARLSKELQA AQARLGADME DVRGRLVQYR GEVQAMLGQS TEELRVRLAS HLRKLRKRLL RDADDLQKRL AVYQAGAREG AERGLSAIRE RLGPLVEQGR VRAATVGSLA GQPLQERAQA WGERLRARME EMGSRTRDRL DEVKEQVAEV RAKLEEQAQQ IRLQAEAFQA RLKSWFEPLV EDMQRQWAGL VEKVQAAVGT SAAPVPSDNH.</p>

<p>Rabbit polyclonal GAPDH antibody (HRP)</p>

<p>Purified Rabbit polyclonal CLCN7 antibody</p>