Biochemicals and Reagents

<p>ENPP1 antibody was raised in Rabbit using Human ENPP1 as the immunogen</p>

<p>Goat anti Rat IgA secondary antibody (Alk Phos)</p>

<p>The Methcathinone antibody is a highly effective neutralizing agent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is specifically designed to target autoantibodies. This antibody has shown remarkable efficacy in inhibiting the activity of acidic molecules such as β-catenin and TGF-beta1 (also known as TGF-β1). Additionally, it has been proven effective in blocking the action of trastuzumab, fibronectin, collagen, and alpha-fetoprotein. The Methcathinone antibody is widely recognized for its exceptional binding affinity and specificity towards TGF-beta, making it an invaluable tool in protein research and therapeutic applications.</p>

<p>Purified recombinant Human SHH protein</p>

<p>Rabbit polyclonal WRKY10 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SH3BP2 antibody, catalog no. 70R-5805</p>

<p>Rabbit polyclonal VTI1B antibody</p>

<p>Rabbit polyclonal TIAF1 antibody</p>

<p>Purified recombinant Human Annexin A7 protein (His tag)</p>

<p>Rabbit polyclonal EXTL3 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TEKT2 antibody, catalog no. 70R-2924</p>

<p>Rabbit polyclonal RUSC1 antibody</p>

<p>The BAT antibody is a highly specific monoclonal antibody that is used in various assays to detect and measure the levels of interferon (IFN) in biological samples. This antibody has been extensively validated and proven to be highly sensitive and specific for IFN detection. It has been shown to neutralize the activity of IFN, making it an essential tool for studying the role of IFN in various biological processes.</p>

<p>Artemis antibody was raised in rabbit using residues 677-692 [GESIAVKKRKCSLLDT] of the human artemis protein as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. This medication is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it prevents transcription and replication, inhibiting bacterial growth. The efficacy of this drug has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>

<p>Rabbit polyclonal PSMD11 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPL3 antibody, catalog no. 70R-4712</p>

<p>Purified recombinant RPL35A protein (His tag)</p>

<p>The Bax antibody is a monoclonal antibody that specifically targets the Bax protein, an important regulator of apoptosis. This antibody recognizes both the amino-terminal and carboxyl-terminal regions of the Bax protein, making it highly effective in detecting and studying Bax expression in various biological samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GOLGA1 antibody, catalog no. 70R-9279</p>

<p>Purified recombinant Human TCEAL7 Protein (His tag)</p>

<p>CALB1 antibody was raised in rabbit using the C terminal of CALB1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RETNLB antibody, catalog no. 70R-10048</p>

<p>The MIOX antibody is a highly specialized monoclonal antibody that is widely used in the field of Life Sciences. It is specifically designed to target and bind to trastuzumab, a steroid-activated monoclonal antibody. The MIOX antibody has been extensively studied and proven to have low density, allowing for enhanced binding affinity to its target.</p>

<p>4EBP1 antibody was raised in Mouse using a purified recombinant fragment of 4EBP1 expressed in E. coli as the immunogen.</p>

<p>FCER1A antibody was raised in Rabbit using Human FCER1A as the immunogen</p>

<p>Rabbit polyclonal MCHR2 antibody</p>

<p>GATA1 antibody was raised in rabbit using residues 211-225 [ATPLWRRDRTGHYL] of the ~42 kDa human protein as the immunogen.</p>

<p>Mouse monoclonal ALDH3A2 antibody</p>

<p>Rabbit Polyclonal Tsc2 antibody (Ser1254)</p>

<p>Rabbit polyclonal PIGK antibody</p>

<p>EIF5A antibody was raised in Rabbit using Human EIF5A as the immunogen</p>

<p>SENP3 antibody was raised using the N terminal of SENP3 corresponding to a region with amino acids PPPKPRLKSGGGFGPDPGSGTTVPARRLPVPRPSFDASASEEEEEEEEEE</p>

<p>The RBM10 antibody is a highly specialized protein that plays a crucial role in various biological processes. It acts as a growth factor and chemokine, promoting the growth and development of cells. Additionally, it has been found to bind to specific receptors such as hepatocyte growth factor and CXCR4, further enhancing its biological activity.</p>

<p>Affinity purified Rabbit polyclonal NDUFS1 antibody</p>

<p>Mouse anti-Creatine Kinase BB (CK-BB) antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DUSP5 antibody, catalog no. 70R-9596</p>

<p>CENPI antibody was raised using the N terminal of CENPI corresponding to a region with amino acids SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FST antibody, catalog no. 70R-1585</p>

<p>VAMP7 antibody was raised in rabbit using the N terminal of VAMP7 as the immunogen</p>

<p>The CD171 antibody is a monoclonal antibody that specifically targets the alpha-synuclein antigen. It is widely used in Life Sciences research to study the role of alpha-synuclein in various diseases and conditions. The CD171 antibody binds to specific epitopes on alpha-synuclein, allowing researchers to detect and analyze its presence in samples. This antibody is highly sensitive and can be used for both qualitative and quantitative analysis. Additionally, it has been shown to have a high affinity for soluble forms of alpha-synuclein, making it a valuable tool for studying its distribution and localization in tissues and body fluids. The CD171 antibody can be used in various techniques such as immunohistochemistry, Western blotting, ELISA, and polymerase chain reaction (PCR) assays. Its use has contributed significantly to our understanding of alpha-synuclein-related diseases and may have potential applications in diagnostics and therapeutics development.</p>

<p>Keratin K5/K8 (Pan Epithelial) antibody (FITC) was raised in mouse using human keratin K8, purified from SDS PAGE gel as the immunogen.</p>

<p>Rabbit polyclonal FAKD3 antibody</p>

<p>PGⅡProtein is a highly versatile protein used in various assays and immunoassays. It is commonly used for neutralizing antibodies, as well as the detection and quantification of autoantibodies. This protein undergoes glycosylation and acid modifications, making it an ideal candidate for studying glycosylation-related diseases or conditions.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EXOC1 antibody, catalog no. 70R-9539</p>

<p>Rabbit polyclonal RPL23 antibody</p>

<p>SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids SNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SENP3 antibody, catalog no. 70R-3545</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC24A1 antibody, catalog no. 70R-7367</p>

<p>HNRNPA1 antibody was raised in Rabbit using Human HNRNPA1 as the immunogen</p>

<p>The HAV VP1 antibody is a monoclonal antibody that specifically targets the nuclear protein VP1 of the Hepatitis A virus (HAV). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Recombinant Human TPST1 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LGTN antibody, catalog no. 70R-4831</p>

<p>UBP1 antibody was raised in mouse using recombinant Human Upstream Binding Protein 1 (Lbp-1A)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RG9MTD1 antibody, catalog no. 70R-4805</p>

<p>KIAA1333 antibody was raised using the N terminal of KIAA1333 corresponding to a region with amino acids IWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKR</p>

<p>Rabbit polyclonal SAPS1 antibody</p>

<p>HGV antibody was raised in rabbit using residues 2268-2276 [CDKCEARQE] of HGV as the immunogen.</p>

<p>GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN</p>

<p>KLRG1 antibody was raised in hamster using activated NK (A-LAK) cells from B6 mice as the immunogen.</p>

<p>LUC7L antibody was raised in rabbit using the middle region of LUC7L as the immunogen</p>

<p>HEF1/NEDD-9 Monoclonal Antibody BSA/Azide Free</p>

<p>The IGF2BP2 antibody is a highly specific monoclonal antibody used in Life Sciences research. It is an inhibitor that targets IGF2BP2, a biomolecule and serum marker involved in various cellular processes. This antibody is designed to specifically bind to IGF2BP2, making it an essential tool for studying its function and regulation. It can be used in experiments involving human enzymes, such as those found in mesenchymal stem cells. The IGF2BP2 antibody is a reliable and effective tool for researchers looking to explore the role of this growth factor and develop potential therapeutic interventions.</p>

<p>PTRH2 antibody was raised using the C terminal of PTRH2 corresponding to a region with amino acids RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRT</p>

<p>Cytokeratin 7 antibody is a growth factor that has been widely used in immunoassays and research studies. This polyclonal antibody specifically targets cytokeratin 7, a protein that is expressed in various types of epithelial cells. It can be used for the detection and quantification of cytokeratin 7 in different tissues and cell lines. The use of this antibody allows for the identification and characterization of specific cell types and can provide valuable insights into cellular processes and functions. With its high specificity and sensitivity, the cytokeratin 7 antibody is an essential tool for life sciences research, including studies on retinoid signaling, protein kinase activity, plasmid transfection, electrospinning, neutralizing antibodies, colloidal stability, glucagon signaling, adrenomedullin function, and more.</p>

<p>Goat anti-rabbit IgG (H+L) (Rhodamine) was raised in goat using rabbit IgG whole molecule as the immunogen.</p>

<p>ARL4C antibody was raised in Rabbit using Human ARL4C as the immunogen</p>

<p>FST antibody was raised using the C terminal of FST corresponding to a region with amino acids SLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN</p>

<p>Rabbit polyclonal CTNNB1 antibody (biotin)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.</p>

<p>The VTCN1 protein is a highly specialized molecule that plays a crucial role in various biological processes. It has been found to have high specific activity in neutralizing superoxide, transferrin, and alpha-fetoprotein. This protein can be targeted using monoclonal antibodies for research purposes in the Life Sciences field. Additionally, it has been shown to interact with fatty acid and nucleotide molecules, as well as annexin A2 and collagen. With its high specificity and low density, the VTCN1 protein offers great potential for further exploration and understanding of its functions in different contexts.</p>

<p>SULF2 antibody was raised using the C terminal of SULF2 corresponding to a region with amino acids DVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKW</p>

<p>TNF receptor type I antibody was raised in rabbit using highly pure recombinant human sTNF-receptor as the immunogen.</p>

<p>ZNF555 antibody was raised in rabbit using the N terminal of ZNF555 as the immunogen</p>

<p>Full length Hepatitis B Core Antigen (HBcAg) (183 amino acids)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TEX2 antibody, catalog no. 70R-6889</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LCAT antibody, catalog no. 70R-7207</p>

<p>S100 antibody was raised in mouse using human brain S-100 protein as the immunogen.</p>

<p>The ABCF1 antibody is a growth factor that plays a crucial role in various biological processes. It is an essential protein involved in the regulation of histidine and choline acetyltransferase, which are enzymes responsible for neurotransmitter synthesis. This monoclonal antibody specifically targets ABCF1 and can be used in assays to detect its presence or measure its activity. Additionally, it has shown potential as a therapeutic agent in the treatment of conditions such as thrombocytopenia and certain types of cancer, including mcf-7 breast cancer cells. The ABCF1 antibody is widely used in life sciences research and offers valuable insights into cellular signaling pathways and cholinergic systems.</p>

<p>Rabbit Polyclonal cJun antibody (Ser243)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPA4 antibody, catalog no. 70R-5578</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ABCA5 antibody, catalog no. 70R-6718</p>

<p>CD28 antibody (Azide free) was raised in hamster using CD28 costimulatory receptor as the immunogen.</p>

<p>GIPC3 antibody was raised in rabbit using the middle region of GIPC3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SNAPC1 antibody, catalog no. 20R-1196</p>

<p>PRKACA antibody was raised in rabbit using the N terminal of PRKACA as the immunogen</p>

<p>OCIAD1 antibody was raised using the C terminal of OCIAD1 corresponding to a region with amino acids QGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPK</p>

<p>FCRL1 antibody was raised using the N terminal of FCRL1 corresponding to a region with amino acids MLPRLLLLICAPLCEPAELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQF</p>

<p>SELENBP1 antibody was raised using the N terminal of SELENBP1 corresponding to a region with amino acids MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVD</p>

<p>Cyclin D1 antibody was raised in mouse using human recombinant full-length cyclin D1 protein as the immunogen.</p>

<p>Purified recombinant Human TCEAL8 protein (His tag)</p>

<p>Purified Polyclonal HADH2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CD34 antibody, catalog no. 70R-10219</p>

<p>Rabbit polyclonal TUBA1B antibody</p>

<p>Rabbit Polyclonal GLRB antibody</p>

<p>Microcide II is a versatile product that offers a wide range of applications in the field of life sciences. It consists of excipients, interferon, liver microsomes, growth factors, antibodies, and antigens. This powerful combination makes it an essential tool for various biological reagent assays.</p>

<p>Rabbit polyclonal PLCH antibody</p>

<p>Recombinant human FGF10 protein (His tag)</p>

<p>Mouse monoclonal PMEL antibody</p>

<p>Rabbit Polyclonal TEBP antibody (Ser113)</p>

<p>ALDH1A1 antibody was raised in Mouse using a purified recombinant fragment of human ALDH1A1 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal PIBF1 antibody</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Mouse monoclonal SLC22A1 antibody</p>

<p>KCNK12 antibody was raised using the middle region of KCNK12 corresponding to a region with amino acids EGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGF</p>

<p>Purified Rabbit polyclonal ZNF763 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AXL antibody, catalog no. 70R-9655</p>

<p>PARP6 antibody was raised in rabbit using the N terminal of PARP6 as the immunogen</p>

<p>Purified recombinant ARPP19 protein (His tag)</p>

<p>Rabbit polyclonal Histone H2A.X antibody</p>

<p>FAM76B antibody was raised using the middle region of FAM76B corresponding to a region with amino acids QQCAFDRKEEGRRKVDGKLLCWLCTLSYKRVLQKTKEQRKSLGSSHSNSS</p>

<p>The EOS antibody is a family kinase inhibitor that is used in the field of Life Sciences. It acts as an inhibitor for glucagon and has been shown to have hydrogen fluoride activity. Additionally, it has been found to interact with alpha-fetoprotein, serine protease, collagen, and other proteins. The EOS antibody is commonly used in various assays and research studies due to its high specificity and efficiency. It is available as Polyclonal Antibodies and can be used in combination with different techniques such as electrode assays and protein kinase assays. With its unique properties and versatility, the EOS antibody offers great potential for advancements in the field of molecular biology and biochemistry.</p>

<p>AQP-3 Blocking Peptide</p>

<p>Factor XIII protein is a growth factor that plays a crucial role in wound healing and tissue repair. It is an anti-glial fibrillary acidic protein (GFAP) monoclonal antibody that specifically targets and inhibits the activity of GFAP, which is expressed in reactive glial cells. Factor XIII protein has been extensively studied in Life Sciences research and is widely used in immunoassays to detect and quantify GFAP levels. This native protein possesses an amino group that allows for easy conjugation with other molecules, such as colloidal gold or trastuzumab (an anti-HER2 antibody). Factor XIII protein is stable in human serum and can be used as a reliable marker for assessing copper concentrations or studying the effects of copper on cellular processes. Its versatility and specificity make it an invaluable tool for researchers in various fields.</p>

<p>The Glutamine Synthetase antibody is a highly effective and reliable tool used in Life Sciences research. This colloidal nanocomposite contains monoclonal antibodies that specifically target glutamine synthetase, an enzyme involved in the synthesis of glutamate. With its high affinity and specificity, this antibody allows for accurate detection and quantification of glutamine synthetase in various samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATXN7 antibody, catalog no. 70R-7983</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Purified recombinant GTLF3B protein (His tag)</p>

<p>HSP105 alpha antibody was raised in mouse using recombinant human Hsp105 alpha (1-858aa) purified from E. coli as the immunogen.</p>

<p>DCTD antibody was raised in Rabbit using Human DCTD as the immunogen</p>

<p>The PPIA antibody is a monoclonal antibody that specifically targets the extracellular domain of the protein peptidylprolyl isomerase A (PPIA). PPIA is an enzyme that plays a crucial role in protein folding and is involved in various cellular processes, including interleukin signaling and antiviral defense. The PPIA antibody has been extensively studied and shown to have high affinity binding to PPIA, making it a valuable tool for research in the Life Sciences field.</p>

<p>PTK6 antibody was raised in Mouse using a purified recombinant fragment of human PTK6 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal NMRAL1 antibody</p>

<p>HIP2 antibody was raised using the N terminal of HIP2 corresponding to a region with amino acids MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTP</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OXCT1 antibody, catalog no. 70R-5323</p>

<p>GNAO1 antibody was raised using the middle region of Gnao1 corresponding to a region with amino acids CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL</p>

<p>Mouse monoclonal FKBP1A antibody</p>

<p>Purified recombinant Human SCGN protein</p>

<p>Rabbit anti-sheep IgG (H+L) was raised in rabbit using sheep IgG whole molecule as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTK2B antibody, catalog no. 70R-6094</p>

<p>Ketanserin is a versatile chemical compound that finds applications in various fields such as biological reagents, electrophoresis, and life sciences. It is commonly used in research and laboratory settings for its ability to interact with specific molecules and proteins. Ketanserin has been found to neutralize the effects of erythropoietin, fibrinogen, phalloidin, and other substances, making it a valuable tool in studying their functions. Additionally, ketanserin can be used as a chemical reference in experiments and assays involving actin filaments, monoclonal antibodies, chemokines, e-cadherin, agglutination assays, and hybridization studies. Its precise mechanisms of action make it an essential component in many scientific investigations.</p>

<p>Rabbit polyclonal TAX1BP3 antibody (FITC)</p>

<p>The Src antibody is a highly specific antibody that targets protein tyrosine kinases, specifically those that are activated. It has been extensively tested and validated using human serum samples and insulin as the target antigen. The antibody recognizes specific amino acid residues on the insulin molecule, making it an excellent tool for research in the field of Life Sciences.</p>

<p>Goat anti-mouse IgG (Fab'2) was raised in goat using murine IgG F(c) fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PODXL2 antibody, catalog no. 70R-8671</p>

<p>The PNMT antibody is a highly specialized monoclonal antibody that is used in various assays. It specifically targets the urokinase plasminogen activator and its inhibitors, making it an essential tool for studying this important target molecule. Additionally, the PNMT antibody has been shown to have cytotoxic effects on certain cell types, making it a promising candidate for targeted therapy. This monoclonal antibody can be used in combination with other antibodies, such as anti-mesothelin or anti-ICOS antibodies, to enhance its efficacy. The PNMT antibody has also been tested in human serum and adipose tissue samples, demonstrating its versatility and potential applications in different research areas. With its high specificity and potency, the PNMT antibody is a valuable tool for researchers studying thrombocytopenia and other related disorders.</p>

<p>Goat anti-rabbit IgG (H+L) was raised in goat using rabbit IgG whole molecule as the immunogen.</p>

<p>Recombinant Human FST protein (His tag)</p>

<p>FTCD antibody is a highly specialized monoclonal antibody that targets the lipoprotein lipase (LPL) enzyme. LPL plays a crucial role in lipid metabolism and is involved in the breakdown of triglycerides into fatty acids for energy utilization. The FTCD antibody specifically binds to LPL, inhibiting its activity and preventing the hydrolysis of triglycerides.</p>

<p>Rabbit polyclonal TULP4 antibody</p>

<p>TMEM104 antibody was raised using the middle region of TMEM104 corresponding to a region with amino acids GDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCWGPLRRVDA</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Klkb1 antibody, catalog no. 70R-8632</p>

<p>Purified Polyclonal RGL1 antibody</p>

<p>The GFAP antibody is a highly specific monoclonal antibody that targets glial fibrillary acidic protein (GFAP). It is widely used in the field of life sciences for research purposes. GFAP is an intermediate filament protein that is predominantly expressed in astrocytes, a type of glial cell in the central nervous system. The GFAP antibody can be used to detect and quantify GFAP levels in various biological samples, including plasma.</p>

<p>The VEGFR1 antibody is a Monoclonal Antibody that specifically targets the vascular endothelial growth factor receptor 1 (VEGFR1). This receptor plays a crucial role in angiogenesis, the formation of new blood vessels. The VEGFR1 antibody binds to VEGFR1 and inhibits its activity, preventing the binding of vascular endothelial growth factors (VEGFs) and subsequent signaling pathways involved in blood vessel development.</p>

<p>Rabbit polyclonal GRIN2B antibody</p>

<p>CLN6 antibody was raised using the C terminal of CLN6 corresponding to a region with amino acids RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA</p>

<p>CSRP2BP antibody was raised in mouse using recombinant Human Csrp2 Binding Protein (Csrp2Bp)</p>

<p>Goat anti-rabbit IgG Fc was raised in goat using rabbit igG, Fc fragment as the immunogen.</p>

<p>Rabbit polyclonal Tau antibody (Ser356)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TP53I13 antibody, catalog no. 70R-9110</p>

<p>Mouse monoclonal KCTD14 antibody</p>

<p>Rabbit polyclonal PIB5 antibody</p>

<p>Purified recombinant AAGAB protein (His tag)</p>

<p>P53 Monoclonal Antibody (FITC)</p>

<p>Mouse Monoclonal Ebola Virus VP40 antibody</p>

<p>Carboxypeptidase B2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI</p>

<p>Rabbit polyclonal Chl81 antibody</p>

<p>Crystallin Gamma C antibody was raised using the middle region of CRYGC corresponding to a region with amino acids GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSE</p>

<p>Rabbit polyclonal SULT4A1 antibody</p>

<p>The PEA15 antibody is an antiviral agent that interacts with interferon and forms an antibody complex. It is widely used in the field of Life Sciences for various applications. The antibody can be used as a colloidal or fluorescent probe for detecting specific molecules or proteins in biological samples. It has been shown to have potential therapeutic effects in conditions such as ischemia-reperfusion injury and certain diseases.</p>

<p>The TRIOBP antibody is a highly specialized monoclonal antibody that targets specific proteins involved in cholinergic and interferon signaling pathways. This antibody is widely used in Life Sciences research to study the function and regulation of these proteins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARHGAP30 antibody, catalog no. 70R-3999</p>

<p>Mouse monoclonal CD90.1 antibody (PE)</p>

<p>RNF39 antibody was raised using the C terminal of RNF39 corresponding to a region with amino acids CRSINSNPHFRPKIMRPHLVSTFPRPCSKPNPFLPSGSQNLLSPTATTVL</p>

<p>POMT2 antibody was raised using the middle region of POMT2 corresponding to a region with amino acids RKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGC</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GFOD1 antibody, catalog no. 70R-3804</p>

<p>The LTA4H antibody is a highly specialized monoclonal antibody that targets the phosphatase enzyme LTA4H. This antibody has been shown to inhibit syncytia formation, which is the fusion of multiple cells into one large cell. Additionally, it neutralizes the activity of growth factors and interleukins, which are important signaling molecules involved in immune responses and inflammation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC35F2 antibody, catalog no. 70R-1795</p>

<p>Purified Rabbit polyclonal OR10A6 antibody</p>

<p>AFG3L2 antibody was raised in Rabbit using Human AFG3L2 as the immunogen</p>

<p>Rat monoclonal IgG1 Isotype Control Fc fusion protein (allophycocyanin)</p>

<p>Purified recombinant Human ADRM1 Protein (His tag)</p>

<p>BAFF antibody was raised in goat using highly pure recombinant human BAFF as the immunogen.</p>

<p>The JAK2 antibody is a highly specific monoclonal antibody that targets the Janus kinase 2 (JAK2) protein. This antibody is produced by hybridoma cells, which are created by fusing mouse myeloma cells with spleen cells from immunized mice. The resulting hybridoma cell line secretes the JAK2 antibody, which can be purified and used for various applications in life sciences research.</p>

<p>Rabbit polyclonal PTTG1IP antibody</p>

<p>MYH10 antibody was raised in Rabbit using Human MYH10 as the immunogen</p>

<p>Rabbit Polyclonal FLT3 antibody (Tyr599)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC9A9 antibody, catalog no. 70R-6808</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACOT12 antibody, catalog no. 70R-4138</p>