Biochemicals and Reagents

<p>Mouse monoclonal CD3 antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DPYSL3 antibody, catalog no. 70R-5235</p>

<p>The DAXX antibody is a versatile and reactive antibody that is commonly used in life sciences research. It is designed to specifically target and bind to DAXX, a protein involved in various cellular processes. This antibody can be used in a wide range of applications, including immunofluorescence, immunohistochemistry, and Western blotting.</p>

<p>Purified Rabbit polyclonal USP50 antibody</p>

<p>Rabbit polyclonal TUBB2B antibody</p>

<p>Rabbit polyclonal LFNG antibody</p>

<p>ACBD4 antibody was raised using the N terminal of ACBD4 corresponding to a region with amino acids NSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI</p>

<p>KIAA1602 antibody was raised in Rabbit using Human KIAA1602 as the immunogen</p>

<p>DNASE2B antibody was raised using the N terminal of DNASE2B corresponding to a region with amino acids EGKAVDWFTFYKLPKRQNKESGETGLEYLYLDSTTRSWRKSEQLMNDTKS</p>

<p>Rabbit anti-sheep IgG (biotin) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.</p>

<p>Recombinant Human MTHFSD protein (His tag)</p>

<p>ACVR2B antibody was raised using the C terminal of ACVR2B corresponding to a region with amino acids HDAEARLSAGCVEERVSLIRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI</p>

<p>Mouse monoclonal PDSS2 antibody</p>

<p>The CD90 Antibody is a highly effective anti-HER2 antibody that targets the growth factor receptor HER2. It is commonly used in combination with other therapies, such as trastuzumab, to treat HER2-positive breast cancer. This monoclonal antibody specifically binds to HER2 receptors, inhibiting their activation and preventing the growth and spread of cancer cells.</p>

<p>HIV1 gp41 antibody (HRP) was raised in goat using recombinant ectodomain of gp41 as the immunogen.</p>

<p>Rabbit Polyclonal NFkB p65 antibody (Ser311)</p>

<p>HOXA9 antibody was raised in mouse using recombinant Class I Homeoprotein (Hoxa9)</p>

<p>Rabbit Polyclonal PAK1/2 antibody</p>

<p>The CD8 Antibody is a chemokine used in Life Sciences research. It specifically targets CXCR4, Annexin, and Streptavidin. This Monoclonal Antibody has cytotoxic and neutralizing properties, making it valuable for studying various cellular processes. It has been shown to inhibit endothelial growth factor and hepatocyte growth factor signaling pathways, as well as TNF-α activation. Additionally, the CD8 Antibody can be used in experiments involving epidermal growth factor and electrode interactions. Its high specificity and potency make it an essential tool for researchers in the field of Life Sciences.</p>

<p>CTCF antibody was raised in Rabbit using Human CTCF as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MYST1 antibody, catalog no. 70R-2166</p>

<p>LGR6 antibody was raised in Rabbit using Human LGR6 as the immunogen</p>

<p>The SHP2 antibody is a highly specific and potent antibody that targets the SHP2 protein. This protein plays a crucial role in various cellular processes, including cell growth, differentiation, and survival. The SHP2 antibody is widely used in life sciences research to study the function and regulation of the SHP2 protein.</p>

<p>Calcitonin antibody is a powerful tool used in life sciences research and diagnostics. It is a type of polyclonal antibody that specifically targets the growth hormone receptor. This antibody recognizes and binds to the receptor, blocking its activity and preventing the binding of growth hormone.</p>

<p>ATPAF1 antibody was raised in Rabbit using Human ATPAF1 as the immunogen</p>

<p>Rabbit polyclonal STEAP1 antibody (biotin)</p>

<p>Purified Polyclonal RNF113B antibody</p>

<p>Rabbit Polyclonal ATF2 antibody (Ser62or44)</p>

<p>RGS7 antibody was raised in rabbit using the N terminal of RGS7 as the immunogen</p>

<p>The Arrestin 1 antibody is a highly effective tool in the field of Life Sciences. This polyclonal antibody specifically targets and neutralizes Arrestin 1, a glycoprotein involved in hormone peptide signaling pathways. By binding to Arrestin 1, this antibody inhibits its function and prevents downstream signaling events, making it an essential tool for studying estrogen receptors and other related processes.</p>

<p>H3F3A antibody was raised in Rabbit using Human H3F3A as the immunogen</p>

<p>LIF antibody was raised using a synthetic peptide corresponding to a region with amino acids KVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQ</p>

<p>Goat anti-mouse IgG/IgM (H+L) (biotin) was raised in goat using Mouse IgG and IgM whole molecules as the immunogen.</p>

<p>OVA conjugated DHEA Hapten</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STX7 antibody, catalog no. 70R-10244</p>

<p>The Annexin A1 antibody is an essential tool in life sciences research. It is a polyclonal antibody that specifically targets Annexin A1, a protein involved in various cellular processes. This antibody recognizes the acidic and cysteine disulfide regions of Annexin A1, allowing for precise detection and analysis.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CSGALNACT1 antibody, catalog no. 70R-6124</p>

<p>Hexokinase 2 antibody was raised using the middle region of HK2 corresponding to a region with amino acids QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLR</p>

<p>SLC15A4 antibody was raised using the N terminal of SLC15A4 corresponding to a region with amino acids  MEGSGGGAGERAPLLGARRAAAAAAAAGAFAGRRAACGAVLLTELLERAA</p>

<p>Purified recombinant Dengue NS1 protein (C-terminal)</p>

<p>Mouse monoclonal EPN2 antibody</p>

<p>The DRAP1 antibody is an active agent that targets glycogen synthase kinase. It falls under the category of Life Sciences and is classified as a Polyclonal Antibody. This antibody specifically targets and activates chloride, making it an effective tool in various medical applications. With its high-flux capabilities, it can be used in assays to detect specific proteins or molecules. The DRAP1 antibody also shows promising results as an anti-mesothelin agent and interferon-stimulated gene inhibitor. Additionally, it has been found to have inhibitory effects on sirtuins, making it a versatile tool in the field of molecular research and drug development.</p>

<p>Rabbit polyclonal VPS72 antibody</p>

<p>Normal Pig Serum is a biospecimen that contains various components essential for research in the life sciences field. It is commonly used in laboratory experiments and veterinary applications.</p>

<p>Mouse monoclonal DTYMK antibody</p>

<p>MMP7 antibody was raised in Rabbit using Human MMP7 as the immunogen</p>

<p>Goat anti-human IgM (Fab'2) (HRP) was raised in goat using human IgM Fc5mu fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC39A11 antibody, catalog no. 70R-7167</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLK13 antibody, catalog no. 70R-3265</p>

<p>Purified Polyclonal Laminin alpha 5 antibody</p>

<p>The Androgen Receptor Antibody is a highly effective tool in the field of Life Sciences. It is a polyclonal antibody that acts as an androgen receptor antagonist, making it ideal for studying the role of androgens in various biological processes. This antibody can be used to detect and quantify the presence of androgen receptors in human serum samples, allowing for a better understanding of their function.</p>

<p>Toxoplasma gondii antibody was raised in rabbit using RH strain of Toxoplasma gondii as the immunogen.</p>

<p>The p53 antibody is a polyclonal antibody that is used for the detection of the p53 protein in various biological samples. It is commonly used in immunohistochemical studies to determine the expression and localization of p53 in tissues. This antibody specifically recognizes the p53 protein, which plays a crucial role in cell cycle regulation and tumor suppression.</p>

<p>Calreticulin 3 antibody was raised using the N terminal of CALR3 corresponding to a region with amino acids MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEK</p>

<p>Rabbit polyclonal KRAS antibody (HRP)</p>

<p>Rabbit polyclonal Coflin 1 and Cofilin 2 antibody</p>

<p>The ATR antibody is a polyclonal antibody that is highly effective in targeting specific antigens. It has been extensively used in various assays in the field of Life Sciences. This antibody exhibits cytotoxic properties and has shown promising results in inhibiting the activity of fibrinogen, glp-1, myostatin, elastase protein, circumsporozoite protein, alpha-synuclein, and natriuretic peptides. Whether you are conducting research or developing diagnostic tools, the ATR antibody is an invaluable tool that can provide accurate and reliable results. With its high specificity and sensitivity, this monoclonal antibody is a must-have for any researcher or scientist working in the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CD8B antibody, catalog no. 70R-5987</p>

<p>CCDC54 antibody was raised using the N terminal of CCDC54 corresponding to a region with amino acids MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLH</p>

<p>Rabbit Polyclonal p70 S6 Kinase antibody (Ser424)</p>

<p>Transferrin antibody was raised in rabbit using human transferrin as the immunogen.</p>

<p>Rabbit polyclonal RABEP2 antibody</p>

<p>AMBN antibody was raised in rabbit using the C terminal of AMBN as the immunogen</p>

<p>Rabbit polyclonal ADCK1 antibody</p>

<p>The IQGAP1 antibody is a highly specialized antibody that targets the protein IQGAP1. This protein plays a crucial role in various cellular processes, including cell signaling, cell adhesion, and cytoskeletal organization. By binding to IQGAP1, this antibody can effectively modulate its activity and function.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf18 antibody, catalog no. 70R-7420</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SDCCAG8 antibody, catalog no. 70R-4002</p>

<p>BCL6B antibody was raised in rabbit using the middle region of BCL6B as the immunogen</p>

<p>The ATF2 antibody is a polyclonal antibody that specifically targets the nuclear protein ATF2. This protein plays a crucial role in various cellular processes, including gene regulation and cell growth. The ATF2 antibody is commonly used in life sciences research to study the interaction between ATF2 and other proteins such as β-catenin and histone H3. It can be used in immunohistochemistry, western blotting, and other techniques to detect the presence of ATF2 in different tissues and cell types. Additionally, this antibody has been shown to have potential therapeutic applications in diseases such as cancer, where aberrant ATF2 activity is often observed. With its high specificity and sensitivity, the ATF2 antibody is a valuable tool for researchers studying cellular signaling pathways and protein interactions.</p>

<p>Rabbit polyclonal ARHGEF17 antibody</p>

<p>C14orf28 antibody was raised in rabbit using the middle region of C14orf28 as the immunogen</p>

<p>COG3 antibody was raised in Rabbit using Human COG3 as the immunogen</p>

<p>CPNE9 antibody was raised in rabbit using the C terminal of CPNE9 as the immunogen</p>

<p>Rabbit polyclonal NFKP p65 antibody (Ser311)</p>

<p>The AK3 antibody is a monoclonal antibody that specifically targets the growth factor AK3. It has been widely used in research and diagnostics to detect the presence of AK3 in various biological samples. The AK3 antibody emits a strong signal when bound to its target, making it highly sensitive and reliable for detecting AK3 levels. Additionally, this monoclonal antibody has been shown to have high affinity and specificity for AK3, ensuring accurate and precise results. Whether you're studying angiogenesis, tumor development, or any other life science-related field, the AK3 antibody is an essential tool for your research. With its ability to accurately measure microvessel density and detect alpha-synuclein in blood plasma, this monoclonal antibody opens up new avenues for understanding disease mechanisms and developing targeted therapies. Trust the power of magnetic particles conjugated with the AK3 monoclonal antibodies for your next experiment or diagnostic assay.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Fadd antibody, catalog no. 70R-3423</p>

<p>Rabbit polyclonal UBA2 antibody</p>

<p>GALNTL4 antibody was raised using the middle region of GALNTL4 corresponding to a region with amino acids IIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHV</p>

<p>MXRA7 antibody was raised using the N terminal of MXRA7 corresponding to a region with amino acids PEPARAPPEPAPPAEATGAPAPSRPCAPEPAASPAGPEEPGEPAGLGELG</p>

<p>Affinity purified Rabbit polyclonal alpha Amylase 2A antibody</p>

<p>PSA antibody is an ultrasensitive detection tool that can be used in various applications. It is designed to detect prostate-specific antigen (PSA) with high accuracy and specificity. The antibody is immobilized on a carbon electrode, which provides a high surface area for efficient binding of the target molecule. This allows for the detection of PSA at very low concentrations.</p>

<p>CFTR antibody was raised in mouse using a synthetic peptide(RKGYRQRLELSD) corresponding to residues 25-36 of human cystic fibrosis transmembrane conductance regulator (CFTR) as the immunogen.</p>

<p>The IL13R antibody is a high-specificity antagonist antibody that is used in Life Sciences research. It is designed to target the interleukin 13 receptor (IL13R), which plays a crucial role in various biological processes. This polyclonal antibody is derived from plasma and has been extensively purified and buffered for optimal performance.</p>

<p>Recombinant Mouse IL34 protein (His tag)</p>

<p>CYP2J2 antibody was raised in Rabbit using Human CYP2J2 as the immunogen</p>

<p>Purified recombinant Human HEBP1 protein (His tag)</p>

<p>The BAK antibody is a monoclonal antibody that is widely used in Life Sciences research. It is specifically designed to target and bind to the BAK protein, which plays a crucial role in the regulation of cell death (apoptosis). This antibody has been extensively validated for use in various immunoassays, including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>IL5 antibody was raised in rabbit using highly pure recombinant human IL-5 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GJD4 antibody, catalog no. 70R-6187</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLUNC antibody, catalog no. 70R-5913</p>

<p>Rabbit polyclonal IKappaB beta antibody</p>

<p>PSAT1 antibody was raised using the N terminal of PSAT1 corresponding to a region with amino acids ADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASY</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF3S9 antibody, catalog no. 70R-4767</p>

<p>Purified Polyclonal CstF50 antibody</p>

<p>Purified Polyclonal CYB561D2 antibody</p>

<p>The Endothelin 1 antibody is a highly specialized product in the field of Life Sciences. It falls under the category of Antibodies and has proven to be effective in various applications such as electrophoresis and colloidal techniques. This antibody specifically targets the epidermal growth factor, which is a crucial growth factor involved in many biological processes.</p>

<p>Human Growth Hormone antibody was raised in Rat using recombinant human growth hormone as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HYAL3 antibody, catalog no. 70R-10387</p>

<p>Rabbit polyclonal PTPN23 antibody</p>

<p>Rabbit polyclonal InsP3R1 antibody</p>

<p>CTAG1B antibody was raised in rabbit using the C terminal of CTAG1B as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC3 antibody, catalog no. 70R-4456</p>

<p>HSPA8 antibody was raised using the N terminal of HSPA8 corresponding to a region with amino acids VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE</p>

<p>Rabbit polyclonal RPS12 antibody (biotin)</p>

<p>100mL of 3 different TMB Peroxidase Substrates ready to use in immunoassays: Ultra sensitivite, Highly Sensitive, and Slow Acting.</p>

<p>Purified recombinant Human TIFA protein (His tag)</p>

<p>CNKSR1 antibody was raised in Rabbit using Human CNKSR1 as the immunogen</p>

<p>Mouse monoclonal Integrin beta 3 antibody (N-terminus)</p>

<p>Purified Polyclonal CLCN7 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GLUD1 antibody, catalog no. 70R-2596</p>

<p>PABPC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ</p>

<p>Rabbit polyclonal ERH antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC6A18 antibody, catalog no. 70R-1802</p>

<p>ADAD2 antibody was raised in Rabbit using Human ADAD2 as the immunogen</p>

<p>The hNRNPC antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the human RNA-binding protein called hnRNPC. This protein plays a crucial role in various cellular processes, including mRNA processing, alternative splicing, and mRNA transport. The hNRNPC antibody can be used for a wide range of applications, such as immunoprecipitation, Western blotting, immunofluorescence, and immunohistochemistry.</p>

<p>EGLN2 antibody was raised in rabbit using the N terminal of EGLN2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NARG1 antibody, catalog no. 70R-4598</p>

<p>Mouse monoclonal GBP2 antibody</p>

<p>KLHL8 antibody was raised in rabbit using the middle region of KLHL8 as the immunogen</p>

<p>Rabbit polyclonal DCLK3 antibody</p>

<p>The CA5A antibody is a polyclonal antibody that specifically targets the acetyltransferase enzyme. This antibody is widely used in life sciences research to study various processes and diseases. It has been shown to be effective in detecting and quantifying the presence of CA5A in samples, making it a valuable tool for researchers working on projects related to cryptosporidium, adeno-associated virus, alpha-fetoprotein, steroid hormones, β-catenin signaling pathway, and cholinergic systems. The CA5A antibody is also commonly used to investigate the role of this enzyme in growth factor and chemokine signaling pathways. Its high specificity and sensitivity make it an ideal choice for experiments requiring accurate detection of the target molecule.</p>

<p>RAB1A antibody was raised using the middle region of RAB1A corresponding to a region with amino acids AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GJB1 antibody, catalog no. 70R-6122</p>

<p>DDX31 antibody was raised using a synthetic peptide corresponding to a region with amino acids QASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTS</p>

<p>IL15 antibody was raised in Rabbit using Human IL15 as the immunogen</p>

<p>Mouse monoclonal ARHGAP25 antibody</p>

<p>DHX58 antibody was raised in Rabbit using Human DHX58 as the immunogen</p>

<p>Mouse monoclonal FSHB antibody</p>

<p>Purified recombinant GSTM1 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC63 antibody, catalog no. 70R-3568</p>

<p>The GPR35 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target the GPR35 receptor, which plays a crucial role in various physiological processes. This chimeric protein consists of an amino-terminal region that binds to the GPR35 receptor and a streptavidin moiety for easy detection and purification.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WNT4 antibody, catalog no. 70R-7471</p>

<p>Recombinant Human PTPN4 protein (His tag)</p>

<p>This antibody reacts with heavy chains on Guinea Pig IgG and light chains on all Guinea Pig immunoglobulins.</p>

<p>The Estrogen Receptor alpha antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets the estrogen receptor alpha, a protein that plays a crucial role in various cellular processes. The antibody is derived from high-quality sources and has been extensively tested for its specificity and effectiveness.</p>

<p>Purified native Human Human Growth Hormone (&gt; 40% pure)</p>

<p>ANTXR2 antibody was raised in Rabbit using Human ANTXR2 as the immunogen</p>

<p>Rabbit Polyclonal DYNLRB2 antibody</p>

<p>The MYC antibody is a highly versatile and potent tool used in various fields such as Life Sciences, industrial applications, and molecular modeling. This antibody exhibits antioxidant activity and has been shown to have an inhibitory effect on protein kinase, making it a valuable asset in the study of cellular processes. The MYC antibody is available as both monoclonal antibodies and polyclonal antibodies, providing researchers with options that best suit their experimental needs. With its ability to specifically bind to activated MYC proteins, this antibody enables accurate detection and analysis of MYC expression levels. Additionally, the MYC antibody can be utilized in molecular docking studies and cyclic peptide development for drug discovery purposes.</p>

<p>GFI1 antibody was raised in Mouse using a purified recombinant fragment of human GFI1 expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SFXN3 antibody, catalog no. 70R-6635</p>

<p>CDON antibody was raised in Rabbit using Human CDON as the immunogen</p>

<p>The STAP2 antibody is a highly specific and sensitive tool used for immunohistochemical detection. It is designed to target the chloride monomer, which serves as a serum marker in human serum. This antibody has been extensively tested and validated for its ability to detect STAP2 in various samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RASGRF1 antibody, catalog no. 70R-5816</p>

<p>Purified recombinant TARDBP protein (His tag)</p>

<p>KCND1 antibody was raised in Rabbit using Human KCND1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARR3 antibody, catalog no. 70R-9876</p>

<p>The PCT monoclonal antibody is a cutting-edge product in the field of Life Sciences. It is specifically designed to target and bind to hepatocyte growth factor, making it a valuable tool for research and diagnostic purposes. This monoclonal antibody is produced by hybridoma cells, ensuring high specificity and purity. The PCT monoclonal antibody has been extensively tested and validated for its effectiveness in various applications, including immunohistochemistry, Western blotting, and ELISA assays. Its unique glycosylation pattern ensures optimal performance and stability. This versatile antibody can be used to study the activation of creatine kinase, antibodies against collagen, apical membrane proteins, human folate receptors, and phosphatase activity. With its exceptional quality and reliability, the PCT monoclonal antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Map2k5 antibody, catalog no. 70R-8801</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PQLC2 antibody, catalog no. 70R-6838</p>

<p>HOXC10 antibody was raised in Rabbit using Human HOXC10 as the immunogen</p>

<p>Mouse monoclonal CD7 antibody (FITC)</p>

<p>The ACRBP antibody is a highly specific monoclonal antibody that is widely used in Life Sciences research. It is commonly employed in various applications, including polymerase chain reactions (PCR), immunoblotting, and immunohistochemistry. This monoclonal antibody specifically targets α-synuclein (α-syn), an important protein involved in neurodegenerative diseases such as Parkinson's disease.</p>

<p>Rabbit polyclonal FOXK1 antibody</p>

<p>The FAM84B antibody is a highly valuable reagent in the field of Life Sciences. It is a monoclonal antibody that specifically targets the FAM84B protein, making it an excellent tool for research and diagnostic purposes. This antibody has been shown to inhibit the activity of FAM84B, which is involved in various cellular processes and pathways. By inhibiting this protein, researchers can gain valuable insights into its function and potential as a biomarker for certain diseases or conditions. The FAM84B antibody is widely used in laboratories and medical institutions as a detection reagent for studying the role of FAM84B in different biological contexts. Its high specificity and sensitivity make it an indispensable tool for scientists working in the field of Life Sciences.</p>

<p>KCNB1 antibody was raised using the middle region of KCNB1 corresponding to a region with amino acids YIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPT</p>

<p>HTR3A antibody was raised in Rabbit using Human HTR3A as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERBP1 antibody, catalog no. 70R-4695</p>

<p>Goat anti-human IgG (H+L) (FITC) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>Troponin T antibody (cardiac) was raised in mouse using bovine TnT as the immunogen.</p>

<p>Purified recombinant PROSC protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPT antibody, catalog no. 70R-1193</p>

<p>Rabbit Polyclonal DHRS11 antibody</p>

<p>The Estrogen Receptor alpha antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the estrogen receptor alpha, which plays a crucial role in various cellular processes including endothelial growth and actin filament formation. This antibody has been shown to be highly specific and activated upon binding to its target. It can be used for various applications such as immunofluorescence, Western blotting, and immunohistochemistry. Additionally, it has been found to have cross-reactivity with other proteins involved in nuclear signaling pathways, such as IFN-gamma and interleukin-6. Researchers can rely on this high-quality antibody to accurately detect and study the expression of estrogen receptor alpha in their experiments.</p>

<p>The CCL7 antibody is a growth factor that belongs to the TGF-beta family. It is a monoclonal antibody that targets and neutralizes CCL7, a chemokine involved in cell migration and inflammation. This antibody has been widely used in Life Sciences research to study the role of CCL7 in various biological processes. It can be used for applications such as immunohistochemistry, Western blotting, and flow cytometry. The CCL7 antibody has also shown potential therapeutic benefits in targeting specific molecules involved in collagen synthesis and endothelial growth. Additionally, it has been found to enhance the efficacy of certain antibiotics and exhibit cell cytotoxicity against multidrug-resistant bacteria. Polyclonal antibodies are also available for detecting multiple epitopes of CCL7.</p>

<p>The ITIH1 antibody is a highly specific monoclonal antibody that targets the influenza hemagglutinin protein. It has been extensively studied and proven to have high affinity and specificity for this target. The antibody can be used in various applications, including immunohistochemistry, western blotting, and ELISA.</p>

<p>The CTNNB1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the CTNNB1 protein, which is found in the apical membrane of cells. This antibody can be used in various applications such as agglutination assays and fluorescence immunochromatography to detect the presence of CTNNB1. It is commonly used in studies involving pluripotent stem cells, interferon signaling, and autoantibodies. The CTNNB1 antibody has been extensively validated and provides reliable results. With its high specificity and sensitivity, it enables accurate detection of CTNNB1 in samples such as human serum or cell lysates. Its primary amino acid sequence ensures consistent performance and reproducibility in experiments. Trust the CTNNB1 antibody for your research needs and unlock new insights into cellular processes and molecular interactions.</p>

<p>A4GNT antibody was raised using the C terminal of A4GNT corresponding to a region with amino acids NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV</p>

<p>SLC26A10 antibody was raised in rabbit using the N terminal of SLC26A10 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A22 antibody, catalog no. 70R-1751</p>

<p>Purified Polyclonal COPS7A antibody</p>

<p>Purified Polyclonal TUSC3 antibody</p>

<p>NLRX1 antibody was raised in Rabbit using Human NLRX1 as the immunogen</p>

<p>MBD3 antibody was raised in Rabbit using Human MBD3 as the immunogen</p>

<p>Rabbit polyclonal VMA21 antibody</p>

<p>Mouse monoclonal CD152 antibody (PE)</p>

<p>GLI4 antibody was raised in Rabbit using Human GLI4 as the immunogen</p>

<p>Mouse monoclonal HIBCH antibody</p>

<p>CGRRF1 antibody was raised using the middle region of CGRRF1 corresponding to a region with amino acids KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIIS</p>

<p>The FANCA antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the FANCA protein, which plays a crucial role in DNA repair and maintenance. By binding to FANCA, this antibody inhibits its proteolytic activity, preventing it from degrading important cellular components.</p>

<p>Rat monoclonal Toll-like receptor 9 antibody</p>