Biochemicals and Reagents

<p>hCG_20426 antibody was raised in rabbit using the N terminal of HCG_20426 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal SLC10A1 antibody</p>

<p>The Histone H4 antibody is a polyclonal antibody that specifically binds to the amino-terminal region of Histone H4. Histones are a group of highly basic and acidic proteins that play a crucial role in DNA packaging and gene regulation. This antibody is widely used in Life Sciences research to study the binding proteins, hormone regulation, and various cellular processes.</p>

<p>The SAP130 antibody is a highly specialized antibody that plays a crucial role in various biological processes. This antibody specifically targets the SAP130 protein, which is involved in the regulation of gene expression and chromatin remodeling. By binding to SAP130, this antibody can modulate the activity of calmodulin, an important calcium-binding protein.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC46A1 antibody, catalog no. 70R-6536</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GTPBP1 antibody, catalog no. 70R-9088</p>

<p>Rabbit anti-goat IgG was raised in rabbit using goat IgG F(ab')2 fragment as the immunogen.</p>

<p>ETFB antibody was raised in Rabbit using Human ETFB as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNA7 antibody, catalog no. 70R-5117</p>

<p>The PNMT antibody is a highly specialized antibody that targets the enzyme phenylethanolamine N-methyltransferase (PNMT). This enzyme plays a crucial role in the conversion of norepinephrine to epinephrine, which is important for regulating blood pressure and stress responses. The PNMT antibody can be used in various research applications, including studying the effects of TGF-beta and trastuzumab on PNMT activity. It is available as both polyclonal and monoclonal antibodies, offering researchers flexibility in their experiments. Additionally, this antibody has cytotoxic properties and can neutralize growth factors like EGF-like proteins. It has also been used to detect collagen and mycoplasma genitalium in life sciences research. With its wide range of applications, the PNMT antibody is an essential tool for scientists studying various biological processes and developing therapeutic inhibitors.</p>

<p>Affinity purified Rabbit polyclonal Ankyrin repeat domain 45 antibody</p>

<p>Desmin antibody was raised using the middle region of DES corresponding to a region with amino acids MALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKT</p>

<p>MLXIPL antibody was raised in rabbit using the N terminal of MLXIPL as the immunogen</p>

<p>The MLK3 antibody is a monoclonal antibody that specifically targets and binds to the MLK3 protein. It is a basic protein that plays a crucial role in various cellular processes, including cell growth, differentiation, and apoptosis. The MLK3 antibody has been extensively tested and validated for its high specificity and sensitivity in detecting activated MLK3 in human serum samples.</p>

<p>18-141 amino acids: MAPTRSPITV TRPWKHVEAI KEALNLLDDM PVTLNEEVEV VSNEFSFKKL TCVQTRLKIF EQGLRGNFTK LKGALNMTAS YYQTYCPPTP ETDCETQVTT YADFIDSLKT FLTDIPFECK KPVQK</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SNAI1 antibody, catalog no. 70R-7981</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Rnf122 antibody, catalog no. 70R-8559</p>

<p>Affinity purified Rabbit polyclonal ORP1 antibody</p>

<p>Influenza B antibody (FITC) was raised in goat using the yamagata strain of Influenza B as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Klf3 antibody, catalog no. 70R-8325</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R2 antibody, catalog no. 70R-10305</p>

<p>Rabbit polyclonal PAK6 antibody</p>

<p>hnRNP F Monoclonal Antibody</p>

<p>Rabbit polyclonal PRMT6 antibody</p>

<p>Rabbit polyclonal PIP4K2A antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POMT2 antibody, catalog no. 70R-6367</p>

<p>CHD2 antibody was raised in Rabbit using Human CHD2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BMP6 antibody, catalog no. 70R-9604</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KHK antibody, catalog no. 70R-2683</p>

<p>The p47phox antibody is a highly specific monoclonal antibody that targets the p47phox protein, which plays a crucial role in immune response and inflammation. This antibody binds to the hyaluronan receptors on the surface of immune cells, facilitating the recognition and elimination of foreign biomolecules. It can be used in various applications within Life Sciences, including research on blood plasma components, isolation of specific antibodies, immobilization on chromatographic columns, and cytotoxicity assays. The p47phox antibody is a valuable tool for scientists studying immune system function, cell signaling pathways, and collagen-related diseases. Its high specificity and affinity make it an essential reagent for accurate and reliable experimental results.</p>

<p>NKAPL antibody was raised using the middle region of NKAPL corresponding to a region with amino acids KTSRSRNKKKRKNKSSKRKHRKYSDSDSNSESDTNSDSDDDKKRVKAKKK</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HK2 antibody, catalog no. 70R-5559</p>

<p>Rabbit polyclonal PCSK7 antibody</p>

<p>Goat anti-chicken IgG (H+L) (biotin) was raised in goat using chicken IgG, whole molecule as the immunogen.</p>

<p>Rabbit polyclonal 4E-BP1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Bmp2 antibody, catalog no. 70R-8617</p>

<p>Rabbit polyclonal MKP1/2 antibody</p>

<p>1-112 amino acids: MGTPKPRILP WLVSQLDLGQ LEGVAWVNKS RTRFRIPWKH GLRQDAQQED FGIFQAWAEA TGAYVPGRDK PDLPTWKRNF RSALNRKEGL RLAEDRSKDP HDPHKIYEFV NS</p>

<p>Affinity purified Rabbit polyclonal PABPC3 antibody</p>

<p>Purified recombinant Human FKBP14 protein</p>

<p>The CDK2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the cyclin-dependent kinase 2 (CDK2) protein, which plays a crucial role in cell growth and division. This antibody has been extensively tested and validated for its specificity and efficacy.</p>

<p>The NUDT21 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the amino-terminal region of NUDT21, a natriuretic peptide receptor that plays a crucial role in regulating cardiovascular function. This neutralizing antibody has been extensively tested and proven to effectively block the binding of NUDT21 to its ligands, inhibiting its downstream signaling pathways. The NUDT21 antibody is widely used in studies investigating the function and regulation of this important receptor, as well as in the development of therapeutic strategies targeting NUDT21-mediated pathways. With its high specificity and affinity, this monoclonal antibody offers researchers a valuable tool for understanding the complex mechanisms involved in cardiovascular health and disease.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Jmjd8 antibody, catalog no. 70R-9594</p>

<p>Rabbit polyclonal OBFC2A antibody</p>

<p>CPLX2 antibody was raised in Rabbit using Human CPLX2 as the immunogen</p>

<p>Trem1 antibody is a monoclonal antibody that specifically binds to the Trem1 antigen. This antibody has been extensively studied for its potential use as an anticancer drug. Trem1 is a protein that is involved in the regulation of inflammation and immune response. It has been found to be overexpressed in various types of cancer, including breast, lung, and colon cancer. The Trem1 antibody has shown promising results in preclinical studies, demonstrating its ability to inhibit tumor growth and metastasis. Additionally, this antibody has also been investigated for its potential therapeutic effects on amyloid proteins associated with neurodegenerative diseases. Trem1 antibody can be used in pharmaceutical preparations for targeted therapy against cancer cells or as a research tool in the field of Life Sciences. Its high specificity and affinity make it an ideal candidate for further development and exploration in the field of immunotherapy.</p>

<p>Rabbit polyclonal CKI gamma antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSD3 antibody, catalog no. 70R-3151</p>

<p>The Cyclin D1 antibody is a globulin-based neutralizing antibody that specifically targets Cyclin D1, a protein involved in cell cycle regulation. This antibody has been extensively studied and proven to effectively inhibit the activity of Cyclin D1, making it a valuable tool for research purposes.</p>

<p>Mouse Serum Albumin is a test substance that plays a crucial role in various biological processes. It is involved in receptor binding, mitogen-activated protein signaling, and the transportation of other molecules within the body. This protein is commonly used as a monoclonal antibody and has excellent pharmacokinetic properties.</p>

<p>LCN1 antibody was raised in Mouse using a purified recombinant fragment of LCN1 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal PLCL2 antibody</p>

<p>Rabbit polyclonal PCDHA2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TKTL2 antibody, catalog no. 70R-1207</p>

<p>Rabbit polyclonal SDHA antibody (biotin)</p>

<p>Affinity purified Rabbit polyclonal BXDC1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WDSUB1 antibody, catalog no. 70R-2815</p>

<p>Rabbit polyclonal GAB1 antibody (Tyr627)</p>

<p>Chicken anti Goat IgG (H + L) secondary antibody</p>

<p>The Citrate Synthetase Antibody is a powerful tool used in Life Sciences research. This antibody specifically targets and binds to citrate synthetase, an enzyme involved in the Krebs cycle. By binding to this enzyme, the antibody allows for the detection and analysis of citrate synthetase levels in various biological samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IGFBP7 antibody, catalog no. 70R-5313</p>

<p>RPL8 antibody was raised using the C terminal of RPL8 corresponding to a region with amino acids KKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAM</p>

<p>Rabbit polyclonal GRM7 antibody (Ser862)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RARRES3 antibody, catalog no. 70R-1725</p>

<p>The MPK3 antibody is a highly specialized monoclonal antibody that targets the lysis and necrosis factor-related apoptosis-inducing pathways. This antibody is designed to specifically bind to adipose tissue, where it can activate chimeric receptors and trigger apoptosis in targeted cells. In addition to its role in adipose tissue, this antibody has been shown to have nuclear localization and can be used for various applications in life sciences research. It is also commonly used as a tool for studying the functions of vasoactive intestinal peptide (VIP) and catechol-o-methyltransferase (COMT). Whether you are conducting basic research or developing new therapeutic strategies, the MPK3 antibody is an invaluable tool for understanding the intricate mechanisms of cellular signaling and regulation.</p>

<p>Myocd antibody was raised in rabbit using the N terminal of Myocd as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Rhebl1 antibody, catalog no. 70R-9197</p>

<p>Purified Guinea Pig Ig fraction for use as a control or blocking reagent</p>

<p>Rabbit Polyclonal JAK1 antibody (Tyr1022)</p>

<p>RBM12 antibody was raised using the middle region of RBM12 corresponding to a region with amino acids VLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAFVHVVTLEDMR</p>

<p>WDR23 antibody was raised using the N terminal of WDR23 corresponding to a region with amino acids GSRNSSSAGSGSGDPSEGLPRRGAGLRRSEEEEEEDEDVDLAQVLAYLLR</p>

<p>Donkey anti-sheep IgG (H + L) (FITC) was raised in donkey using sheep IgG (H&amp;L) as the immunogen.</p>

<p>Fresh tissue lysate isolated from human pancreas</p>

<p>Salmonella typhi Antibody is a monoclonal antibody that specifically targets Salmonella typhi, the bacteria responsible for causing typhoid fever. This antibody contains specific amino acid residues that bind to antigens present on the surface of Salmonella typhi. It has been shown to be effective in neutralizing the bacteria and preventing its growth and spread.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NETO2 antibody, catalog no. 70R-7286</p>

<p>The Annexin A3 antibody is an essential antibody-drug that plays a crucial role in various biological processes. It specifically targets and binds to Annexin A3, a protein involved in glucagon receptor binding and antigen presentation. This antibody is available in both polyclonal and monoclonal forms, offering versatility for different research applications.</p>

<p>ALKBH8 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEIISSEEEKMLLESVDWTEDTDNQNSQKSLKHRRVKHFGYEFHYENNNV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNASE1 antibody, catalog no. 70R-7106</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC19A1 antibody, catalog no. 70R-1803</p>

<p>Region of Fractalkine protein corresponding to amino acids QHHGVTKCNI TCSKMTSKIP VALLIHYQQN QASCGKRAII LETRQHRLFC ADPKEQWVKD AMQHLDRQAA ALTRNG.</p>

<p>Smpdl3a antibody was raised in rabbit using the N terminal of Smpdl3a as the immunogen</p>

<p>CACYBP antibody was raised using the middle region of CACYBP corresponding to a region with amino acids FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKK</p>

<p>Rabbit polyclonal HARS antibody</p>

<p>Goat anti-human IgG (H+L) (Rhodamine) was raised in goat using human IgG whole molecule as the immunogen.</p>

<p>Rabbit polyclonal HNRPH1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXW10 antibody, catalog no. 70R-3251</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC7A14 antibody, catalog no. 70R-1797</p>

<p>Affinity purified Rabbit polyclonal PTPN11 antibody</p>

<p>The PKMYT1 antibody is a mouse monoclonal antibody that is used as a diagnostic agent in the field of Life Sciences. It specifically targets and binds to PKMYT1, a cytosolic protein involved in cell cycle regulation. This antibody can be used for various applications such as immunohistochemistry, Western blotting, and flow cytometry. Its high specificity and affinity make it an ideal tool for studying the expression and localization of PKMYT1 in different tissues and cell types. Additionally, this antibody has been shown to have genotoxic effects on pluripotent stem cells, making it a valuable tool for research in regenerative medicine. With its ability to detect activated PKMYT1 and its potential use in diagnosing diseases associated with abnormal cell cycle regulation, this antibody holds great promise in advancing our understanding of various biological processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPINT2 antibody, catalog no. 70R-9690</p>

<p>The CDC25C antibody is a powerful tool used in Life Sciences research. It is an enzyme substrate that can be used for chromatographic analysis of reactive oxygen species (ROS) and binding proteins. This antibody specifically targets CDC25C, a protein kinase involved in cell cycle regulation. By targeting and inhibiting CDC25C, this antibody can effectively disrupt the cell cycle and inhibit cell division.</p>

<p>The BCL2 antibody is a highly specialized product in the field of Life Sciences. This antibody is designed to target and bind to the B-cell lymphoma 2 (BCL2) protein, which plays a crucial role in regulating cell death and survival. The BCL2 antibody can be used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>Affinity purified Rabbit polyclonal Serpina 4 antibody</p>

<p>WBP4 antibody was raised in rabbit using the N terminal of WBP4 as the immunogen</p>

<p>The Ezrin antibody is a powerful tool in the field of life sciences. It is a neutralizing antibody that specifically targets β-catenin, an important protein involved in cell adhesion and signaling pathways. This polyclonal antibody can be used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Tgfb3 antibody, catalog no. 70R-8628</p>

<p>ACOT2 antibody was raised in Rabbit using Human ACOT2 as the immunogen</p>

<p>Rabbit polyclonal OR52D1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TAGLN 3 antibody, catalog no. 70R-9267</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TGM3 antibody, catalog no. 70R-3925</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2N antibody, catalog no. 70R-1157</p>

<p>ARL8B antibody was raised in Rabbit using Human ARL8B as the immunogen</p>

<p>Rabbit polyclonal TRAP1 antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RANGAP1 antibody, catalog no. 70R-5479</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GOPC antibody, catalog no. 70R-3007</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POGZ antibody, catalog no. 70R-8313</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Additionally, this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EXOC4 antibody, catalog no. 70R-9378</p>

<p>Rabbit Polyclonal p38 MAPK antibody (Tyr182)</p>

<p>Abo antibody was raised in rabbit using the middle region of Abo as the immunogen</p>

<p>Rabbit anti-chicken IgG was raised in rabbit using chicken IgG F(c) fragment as the immunogen.</p>

<p>Rabbit polyclonal Connexin 43 antibody (Ser265)</p>

<p>Affinity purified Rabbit polyclonal STRA8 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF501 antibody, catalog no. 70R-8992</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HCN3 antibody, catalog no. 70R-5168</p>

<p>Ascc1 antibody was raised in rabbit using the C terminal of Ascc1 as the immunogen</p>

<p>Purified recombinant Human ANXA13 protein</p>

<p>Affinity purified Rabbit polyclonal Integrin alpha X antibody</p>

<p>Rabbit polyclonal Claudin 5 antibody (Tyr217)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DKC1 antibody, catalog no. 70R-5644</p>

<p>Keratin K8 protein is a vital component of the human hepatocytes and plays a crucial role in various biological processes. It is involved in maintaining the structural integrity of liver cells and regulating gene expression through messenger RNA (mRNA) stabilization. Keratin K8 protein is also known to interact with several cytochrome P450 (CYP) isoforms, which are responsible for metabolizing drugs and other xenobiotics in the liver.</p>

<p>Rabbit polyclonal PHACTR4 antibody</p>

<p>Rabbit polyclonal TNAP1 antibody</p>

<p>CST8 antibody was raised in rabbit using the N terminal of CST8 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal USP47 antibody</p>

<p>U2AF2 antibody was raised using the N terminal of U2AF2 corresponding to a region with amino acids EFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSAS</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF2C1 antibody, catalog no. 70R-3471</p>

<p>NCKAP1 antibody was raised in Rabbit using Human NCKAP1 as the immunogen</p>

<p>The GFAP protein is a highly specialized protein that plays a crucial role in various biological processes. It is involved in glutamate metabolism and can be found in human serum. The protein has been extensively studied using techniques such as polymerase chain reaction (PCR) and electrode assays.</p>

<p>FAM13C1 antibody was raised using the N terminal of FAM13C1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EDA antibody, catalog no. 70R-5943</p>

<p>CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS</p>

<p>Affinity purified Rabbit polyclonal AKR7A2 antibody</p>

<p>KHDRBS2 antibody was raised in rabbit using the N terminal of KHDRBS2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AKAP1 antibody, catalog no. 70R-5027</p>

<p>Rabbit polyclonal ADCY7 antibody</p>

<p>Region of MCP3 protein corresponding to amino acids QPVGINTSTT CCYRFINKKI PKQRLESYRR TTSSHCPREA VIFKTKLDKE ICADPTQKWV QDFMKHLDKK TQTPKL.</p>

<p>QRFPR antibody was raised in rabbit using the C terminal of QRFPR as the immunogen</p>

<p>The NFkB p65 antibody is a polyclonal antibody that targets the NFkB p65 protein. This protein plays a crucial role in various cellular processes, including the regulation of gene expression and immune response. The NFkB p65 antibody specifically binds to the NFkB p65 protein, allowing for its detection and analysis in various experimental settings.</p>

<p>The EFNA5 antibody is a highly specialized polyclonal antibody that targets EFNA5, a protein involved in various biological processes. This antibody has been extensively studied and proven to be effective in detecting and neutralizing EFNA5 in different research applications.</p>

<p>DIDO1 antibody was raised in Rabbit using Human DIDO1 as the immunogen</p>

<p>Purified Rabbit polyclonal OR10G6 antibody</p>

<p>Scara3 antibody was raised in rabbit using the middle region of Scara3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCDHAC1 antibody, catalog no. 70R-6120</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SNTG1 antibody, catalog no. 70R-3733</p>

<p>The Human IgG Fc fragment is a purified immunoglobulin that is commonly used in the field of life sciences. It is derived from human serum and has been activated through various processes such as fatty acid acetylation. This fragment plays a crucial role in immune responses by binding to specific receptors, including the growth factor-1 receptor, acidic growth factor, alpha-fetoprotein, telomerase, and antibodies. Additionally, it has been found to interact with chemokines and natriuretic factors. The Human IgG Fc fragment is widely utilized in research and diagnostic applications for its ability to accurately detect and quantify target molecules. Its high specificity and affinity make it an invaluable tool for studying immune responses and developing therapeutic interventions.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FRS3 antibody, catalog no. 70R-2077</p>

<p>The Chk1 antibody is a highly specialized antibody that specifically targets activated proteins in human serum. It binds to agonist proteins and neutralizes their effects, preventing them from causing any harm. The Chk1 antibody also has the ability to bind to serum albumin protein, enhancing its stability and prolonging its effectiveness.</p>

<p>EFS antibody was raised in Rabbit using Human EFS as the immunogen</p>

<p>The ACT1 antibody is a polyclonal antibody that specifically targets CD33, a cell surface protein. It has chemokine-neutralizing properties and can be used in various immunoassays and life science research. The ACT1 antibody is also available as a monoclonal antibody and can be used as an inhibitor of TNF-α, a pro-inflammatory cytokine. Additionally, this antibody has the ability to bind to nuclear proteins and neurotrophic factors such as TGF-β1 and natriuretic peptides. With its wide range of applications, the ACT1 antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNFSF13 antibody, catalog no. 70R-10214</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNASEH2A antibody, catalog no. 70R-1626</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPR18 antibody, catalog no. 70R-10503</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CTPS antibody, catalog no. 70R-1030</p>

<p>Mouse pan macrophages antibody was raised in rat using cultured macrophages as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNHIT3 antibody, catalog no. 70R-8914</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYB5D1 antibody, catalog no. 70R-3280</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Pigw antibody, catalog no. 70R-8806</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting transcription and replication. Its efficacy has been proven through extensive research using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.</p>

<p>Rabbit polyclonal H3F3A antibody (HRP)</p>

<p>HPSE antibody was raised in rabbit using the N terminal of HPSE as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX19B antibody, catalog no. 70R-1388</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AK5 antibody, catalog no. 70R-3556</p>

<p>Recombinant human VAT1 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD54 antibody, catalog no. 70R-4555</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of YPEL5 antibody, catalog no. 70R-9444</p>

<p>The HSPA9 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets HSPA9, also known as heat shock 70kDa protein 9. This protein plays a crucial role in various cellular processes, including cell survival and apoptosis.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C11orf67 antibody, catalog no. 70R-4245</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OPN5 antibody, catalog no. 70R-9904</p>

<p>Purified Rat IgG (Fab) FITC conjugate</p>

<p>Purified recombinant Human RBP5 protein</p>

<p>The CO1 antibody is a monoclonal antibody that specifically targets and neutralizes the CO1 protein. This protein is involved in various biological processes, including the regulation of brain natriuretic peptide levels and interferon production. The CO1 antibody has been extensively studied in Life Sciences research and has shown promising results as an antiviral agent. It can be used in laboratory experiments to study the function of the CO1 protein or as a potential therapeutic option for certain diseases. The CO1 antibody is formulated with high-quality excipients to ensure stability and efficacy. Additionally, polyclonal antibodies are also available for researchers who require a broader range of target recognition. Trust the CO1 antibody for reliable and accurate results in your scientific endeavors.</p>

<p>Rabbit Polyclonal CHK2 antibody (Thr387)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IFRD1 antibody, catalog no. 70R-1986</p>

<p>ZNF385D antibody was raised in rabbit using the N terminal of ZNF385D as the immunogen</p>

<p>Rabbit polyclonal RPS18 antibody (FITC)</p>

<p>CLTA antibody was raised in Rabbit using Human CLTA as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC5A7 antibody, catalog no. 70R-7211</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIGQ antibody, catalog no. 70R-6647</p>

<p>GABBR2 antibody was raised in rabbit using the C terminal of GABBR2 as the immunogen</p>

<p>Calcitonin antibody is a specialized product used in the field of Life Sciences. It acts as an immunosuppressant and inhibitor, targeting specific molecules and pathways in the body. This antibody is colloidal in nature and can be used in various applications such as research, diagnostics, and therapeutics.</p>