Biochemicals and Reagents

<p>CD8b antibody was raised in Mouse using the beta chain of chicken CD8 as the immunogen.</p>

<p>ALOX5 antibody was raised in Rabbit using Human ALOX5 as the immunogen</p>

<p>Purified recombinant RPRD1A protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM54A antibody, catalog no. 70R-3511</p>

<p>The NDKA antibody is a specific antibody that targets alpha-fetoprotein (AFP), a protein that is often elevated in certain diseases and conditions. This antibody acts as a family kinase inhibitor, blocking the activity of proteins involved in cell signaling pathways. It can be used in various research applications, including Western blotting, immunohistochemistry, and ELISA assays. The NDKA antibody is produced using polyclonal or monoclonal antibody production methods, ensuring high specificity and sensitivity. It can be used to study the role of AFP in different biological processes, such as development, cancer progression, and hormone regulation. The NDKA antibody is supplied with saponin for enhanced permeabilization of cells during staining procedures. It has been validated for use in various species and sample types, including human serum and tissue samples. With its ability to target AFP specifically, the NDKA antibody is an invaluable tool for researchers in the Life Sciences field.</p>

<p>MYOC antibody was raised in Rabbit using Human MYOC as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ASB17 antibody, catalog no. 70R-4574</p>

<p>ENG antibody was raised in Rabbit using Human ENG as the immunogen</p>

<p>The LGR6 antibody is a protein that belongs to the group of polyclonal antibodies. It is commonly used in life sciences research for various applications. This antibody specifically targets LGR6, a receptor protein involved in several biological processes. It has been shown to have autoantibody properties and can be used in immunohistochemistry and immunofluorescence assays to detect LGR6 expression in tissues or cells.</p>

<p>TERF2 antibody was raised in rabbit using the C terminal of TERF2 as the immunogen</p>

<p>MOGAT2 antibody was raised in Rabbit using Human MOGAT2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GNPDA1 antibody, catalog no. 70R-3271</p>

<p>Rabbit polyclonal GNL1 antibody</p>

<p>Rabbit polyclonal DNAPK antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GRAMD2 antibody, catalog no. 70R-6309</p>

<p>The DUSP3 antibody is a multidrug antibody that targets TGF-beta, a key signaling molecule involved in various cellular processes. This antibody can be used in life sciences research to study the effects of TGF-beta on different cell types. It has been shown to neutralize the activity of TGF-beta and inhibit its downstream signaling pathways. Additionally, the DUSP3 antibody has been found to have inhibitory effects on collagen production, epidermal growth factor signaling, vasoactive intestinal peptide activity, interferon production, and TNF-alpha signaling. With its wide range of applications and potent neutralizing properties, the DUSP3 antibody is a valuable tool for researchers studying TGF-beta-related processes and diseases.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM54 antibody, catalog no. 70R-2019</p>

<p>ATP5B antibody was raised using the N terminal of ATP5B corresponding to a region with amino acids PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CEL antibody, catalog no. 70R-5366</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Tbcb antibody, catalog no. 70R-9129</p>

<p>Armenian Hamster monoclonal TCR beta antibody (allophycocyanin)</p>

<p>The TSPAN12 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets TSPAN12, a glycoprotein found on the surface of human cells. This antibody has been extensively studied and shown to have cytotoxic effects on various cell types, including cardiomyocytes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNJ12 antibody, catalog no. 70R-5160</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of APP antibody, catalog no. 70R-6194</p>

<p>MST1R antibody was raised in Mouse using a purified recombinant fragment of human MST1R (aa210-320) expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR13C5 antibody, catalog no. 70R-7872</p>

<p>Rabbit polyclonal TRBP antibody</p>

<p>Rat monoclonal IgM antibody (allophycocyanin)</p>

<p>ZNF682 antibody was raised in rabbit using the middle region of ZNF682 as the immunogen</p>

<p>The IGF2BP2 antibody is a powerful tool used in the field of life sciences. It is a monoclonal antibody that has been extensively studied and characterized using mass spectrometric methods. This antibody plays a crucial role in various biological processes, including syncytia formation, growth factor signaling, and virus surface antigen activation.</p>

<p>The EDG6 antibody is a protein that acts as a phosphatase. It is a polyclonal antibody that is commonly used in the field of life sciences. This antibody specifically targets the hepatocyte growth factor, which plays a crucial role in cell growth and development. The EDG6 antibody can be used to detect and measure the levels of this growth factor in various biological samples. Additionally, this antibody has been shown to interact with other proteins such as fibrinogen, steroids, glycosylation enzymes, natriuretic peptides, mycoplasma genitalium, activated dopamine receptors, and growth factors. Its specificity and high affinity make it an essential tool for researchers studying these pathways. Order your EDG6 antibody today and unlock new insights into cellular signaling and protein interactions.</p>

<p>1,2-Dipalmitoyl-d62-sn-glycero-3-phosphocholine-N,N,N-trimethyl-d9 is a deuterated phospholipid, which is an important tool in biophysical research. This molecule is sourced from the synthetic modification of natural phosphatidylcholine, incorporating deuterium atoms to enhance its utility in specialized studies. The deuterium labeling replaces hydrogen atoms, which significantly reduces background noise and enhances signal clarity in spectroscopic techniques like NMR and neutron scattering.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF582 antibody, catalog no. 70R-8112</p>

<p>PHKG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV</p>

<p>EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug classified under rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of the bacteria. Extensive research has been conducted on its human activity using the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations like hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C3orf19 antibody, catalog no. 70R-4349</p>

<p>RASSF1 antibody was raised in rabbit using the C terminal of RASSF1 as the immunogen</p>

<p>OXCT1 antibody was raised using the middle region of OXCT1 corresponding to a region with amino acids GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN</p>

<p>Purified recombinant Human FKBPL protein</p>

<p>GABARAP antibody was raised in rabbit using Residues 15-31 [RSEGEKIRKKYPDRVPV] of the GABARAP protein as the immunogen.</p>

<p>TRIM37 antibody was raised using the middle region of TRIM37 corresponding to a region with amino acids GMSSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQmolecular weight (Uniprot) is 108kDa</p>

<p>Progesterone is a steroid hormone that acts as a nuclear receptor in the body. It plays a crucial role in various physiological processes, including the menstrual cycle and pregnancy. Progesterone can be measured in blood plasma using immunoassays, such as flow assays, which utilize monoclonal antibodies specific to progesterone. These antibodies bind to progesterone molecules, allowing for accurate measurement of progesterone concentration. Synthetic progesterone analogs have also been developed for use in research and medical applications. Additionally, surface modification techniques can be employed to immobilize monoclonal antibodies on solid supports, enabling the development of robust and sensitive progesterone detection systems. Overall, progesterone is a vital hormone with diverse functions and its measurement is essential in various fields, including Life Sciences and clinical diagnostics.</p>

<p>Rabbit polyclonal PLD1 antibody (Ser561)</p>

<p>The TrkA antibody is a highly specialized monoclonal antibody that targets the growth factor receptor TrkA. This receptor plays a crucial role in cell growth, survival, and differentiation. By binding to the virus surface antigen, the TrkA antibody effectively inhibits the activation of this receptor, preventing abnormal cell growth and proliferation.</p>

<p>Rabbit polyclonal SLC24A6 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DLL1 antibody, catalog no. 70R-6123</p>

<p>Rabbit polyclonal RANBP3L antibody</p>

<p>Mouse monoclonal CagA protein antibody (Helicobacter pylori)</p>

<p>Purified Polyclonal PDGFB antibody</p>

<p>PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF565 antibody, catalog no. 70R-8994</p>

<p>CD5 antibody (FITC) was raised in mouse using human CD5 as the immunogen.</p>

<p>MAPKAPK2 antibody was raised in rabbit using the middle region of MAPKAPK2 as the immunogen</p>

<p>The MMP16 antibody is a highly effective substance used in Life Sciences research. It is a monoclonal antibody that specifically targets the matrix metalloproteinase 16 (MMP16), also known as MT3-MMP. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting MMP16 expression in various tissues and cell types.</p>

<p>Purified recombinant PHF5A protein (His tag)</p>

<p>Rabbit polyclonal PUB45 antibody</p>

<p>TMEM144 antibody was raised using the middle region of TMEM144 corresponding to a region with amino acids LSTVHHRIVGCSLAVISGVLYGSTFVPIIYIKDHSKRNDSIYAGASQYDL</p>

<p>ZNF618 antibody was raised in rabbit using the N terminal of ZNF618 as the immunogen</p>

<p>1-241 amino acids: MGSSHHHHHH SSGLVPRGSH MAEEQPQVEL FVKAGSDGAK IGNCPFSQRL FMVLWLKGVT FNVTTVDTKR RTETVQKLCP GGQLPFLLYG TEVHTDTNKI EEFLEAVLCP PRYPKLAALN PESNTAGLDI FAKFSAYIKN SNPALNDNLE KGLLKALKVL DNYLTSPLPE EVDETSAEDE GVSQRKFLDG NELTLADCNL LPKLHIVQVV CKKYRGFTIP EAFRGVHRYL SNAYAREEFA STCPDDEEIE LAYEQVAKAL K</p>

<p>BNIP1 antibody was raised in rabbit using the C terminal of BNIP1 as the immunogen</p>

<p>The XRCC5 antibody is a cytotoxic monoclonal antibody that specifically targets XRCC5, a protein involved in DNA repair. This antibody has been shown to have high specificity and affinity for XRCC5, making it an effective tool for studying the function of this protein in various biological processes. The XRCC5 antibody can be used in applications such as immunohistochemistry, western blotting, and flow cytometry to detect and quantify XRCC5 levels in different cell types and tissues. Additionally, this antibody has potential therapeutic applications, as it can induce cell death in cancer cells that overexpress XRCC5. Overall, the XRCC5 antibody is a valuable research tool for scientists studying DNA repair mechanisms and developing targeted therapies for cancer treatment.</p>

<p>The SKP2 antibody is a highly activated and colloidal growth factor that belongs to the class of antibodies. It is a monoclonal antibody that has neutralizing properties and can effectively target autoantibodies. This antibody undergoes acid modifications, such as glycosylation, which enhance its stability and efficacy. The SKP2 antibody specifically targets the protein kinase SKP2, which plays a crucial role in cell cycle regulation and tumor development. In Life Sciences research, this monoclonal antibody is widely used for various applications, including immunohistochemistry, Western blotting, and flow cytometry. Its high specificity and affinity make it an ideal test compound for studying the functions of SKP2 in cellular processes.</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>SLC9A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL</p>

<p>The Alpha synuclein antibody is a cytotoxic antibody used in Life Sciences. It is available in both polyclonal and monoclonal forms. This antibody specifically targets alpha synuclein, a protein that is associated with neurodegenerative diseases such as Parkinson's disease. The alpha synuclein antibody can be used for research purposes to study the role of this protein in various cellular processes.</p>

<p>PYHIN1 antibody was raised in rabbit using the N terminal of PYHIN1 as the immunogen</p>

<p>TRIM49 antibody was raised using the N terminal of TRIM49 corresponding to a region with amino acids RPCFYLNWQDIPFLVQCSECTKSTEQINLKTNIHLKKMASLARKVSLWLF</p>

<p>DBH antibody was raised in rabbit using an 18 amino acid peptide of human DBH as the immunogen.</p>

<p>Annexin A2 antibody was raised using the C terminal of ANXA2 corresponding to a region with amino acids RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD</p>

<p>Perforin antibody was raised in rabbit using E. coli-expressed rat perforin as the immunogen.</p>

<p>Rabbit polyclonal APLP2 antibody (Tyr755)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPDL antibody, catalog no. 70R-4655</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC6 antibody, catalog no. 70R-6067</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMCC1 antibody, catalog no. 70R-6287</p>

<p>The TGFBR2 antibody is a polyclonal antibody that specifically targets the transforming growth factor beta receptor 2 (TGFBR2). It is commonly used in research and diagnostic applications to detect and quantify the expression of TGFBR2. This antibody binds to the activated form of TGFBR2, inhibiting its interaction with other proteins involved in signal transduction pathways. Additionally, it has been shown to block the binding of interferon-gamma (IFN-gamma) to TGFBR2, suggesting a potential role in modulating immune responses. The TGFBR2 antibody is available as both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. Its high specificity and sensitivity make it a valuable tool for studying the function and regulation of TGFBR2 in various biological systems.</p>

<p>The NRG4 antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of nuclear retinoid receptors. It has been extensively studied in the field of Life Sciences and has shown promising results as a potential therapeutic agent. The NRG4 antibody works by blocking the acetylation process that is crucial for the activation of retinoid receptors, thereby preventing their interaction with DNA and subsequent gene expression. This inhibition has been shown to have significant effects on various cellular processes, including collagen production, which makes it a valuable tool for studying and understanding the role of retinoids in cell biology. Additionally, the NRG4 antibody can be used in the development of novel medicines and vaccines targeting retinoid-related diseases and disorders. Its specificity and efficacy make it an essential component in research and diagnostic applications requiring reliable and accurate detection of retinoid receptors.</p>

<p>The RORA antibody is a highly specialized antibody that targets the retinoid-related orphan receptor alpha (RORA). This receptor plays a crucial role in regulating gene expression and is involved in various biological processes, including immune response, metabolism, and circadian rhythm. The RORA antibody can be used for research purposes in the field of life sciences to study the function and activity of this important receptor.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTPN1 antibody, catalog no. 70R-6625</p>

<p>OVCA2 Antibody</p>

<p>The PAWR antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. It has been found to be effective in neutralizing autoantibodies, stimulating colony growth, and regulating the epidermal growth factor. Additionally, this antibody has shown promising results in inhibiting caspase-9 activity, which is essential for apoptosis.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYTB antibody, catalog no. 70R-7028</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection and contains active compounds known for their bactericidal activity. Through its unique mechanism, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has been conducted using the patch-clamp technique on human erythrocytes, demonstrating its high efficacy in human subjects.</p>

<p>Purified recombinant RAB5C protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GSTK1 antibody, catalog no. 70R-2610</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLEC4M antibody, catalog no. 70R-8545</p>

<p>Rabbit polyclonal IKK alpha/beta antibody (Ser176)</p>

<p>TIMELESS antibody was raised in rabbit using the N terminal of TIMELESS as the immunogen</p>

<p>Affinity purified Rabbit polyclonal NDRG1 antibody</p>

<p>TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF799 antibody, catalog no. 70R-8173</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM187 antibody, catalog no. 70R-7383</p>

<p>The HDAC10 antibody is a highly specific monoclonal antibody that targets the histone deacetylase 10 (HDAC10) protein. HDAC10 is a member of the histone deacetylase family that plays a crucial role in gene expression regulation. This antibody is widely used in Life Sciences research to study the function and activity of HDAC10.</p>

<p>CRYBB3 antibody was raised in Rabbit using Human CRYBB3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATG4D antibody, catalog no. 70R-9614</p>

<p>The CD71 antibody is a polyclonal antibody that is widely used in Life Sciences research. It is commonly used in studies involving neuroprotection, as well as the detection and quantification of active agents. The CD71 antibody has been shown to have a high affinity for methyl methanesulfonate (MMS), a genotoxic agent often used in genotoxicity assays. Additionally, this antibody can be conjugated with fluorescent calcium indicators to study intracellular calcium dynamics. It is also commonly used in the detection of autoantibodies and growth factors. The CD71 antibody has been validated in various assays, including the micronucleus test, and has shown excellent performance and specificity. Its use can provide valuable insights into cellular processes and signaling pathways.</p>

<p>AGAP2 antibody was raised in Rabbit using Human AGAP2 as the immunogen</p>

<p>Fibrillarin antibody was raised using the N terminal of FBL corresponding to a region with amino acids GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PALM antibody, catalog no. 70R-9381</p>

<p>ORC1 Monoclonal Antibody</p>

<p>Purified recombinant Human PCBD1 protein</p>

<p>Affinity purified Rabbit polyclonal Nucleoporin p62 antibody</p>

<p>Glicentin/Glucagon antibody was raised in rabbit using Porcine pancreatic glucagon conjugated to BSA as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MGC70863 antibody, catalog no. 70R-4813</p>

<p>Influenza A antibody was raised in mouse using influenza virus type A haemagglutinin H1 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHN1 antibody, catalog no. 70R-5735</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DYDC1 antibody, catalog no. 70R-4150</p>

<p>Rabbit polyclonal TUBA1A antibody</p>

<p>PARD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQQMKKQPPSEGPSNYDSYKKVQDPSYAPPKGPFRQDVPPSPSQVARLNR</p>

<p>Troponin I antibody (cardiac) was raised in mouse using amino acid residues 86-90 of cTnI as the immunogen.</p>

<p>Rsk1 antibody was raised in Mouse using a purified recombinant fragment of human Rsk1 expressed in E. coli as the immunogen.</p>

<p>DOK1 antibody was raised in rabbit using the C terminal of DOK1 as the immunogen</p>

<p>Myeloperoxidase protein is a hormone and globulin that plays a crucial role in endothelial growth and binding proteins. It acts as a growth factor, promoting the development and maintenance of blood vessels. The protein also has phosphatase activity, which regulates various signaling pathways involved in cell growth and differentiation.</p>

<p>The CDC37 antibody is a growth factor that plays a crucial role in various biological processes. It is a colloidal fatty acid that regulates thrombocytopenia, chemokine production, and interleukin-6 signaling. The CDC37 antibody is a monoclonal antibody that specifically targets the family kinase inhibitor, collagen, and other growth factors. It can be used in research and diagnostic applications to study the effects of these proteins on cell signaling pathways. Additionally, polyclonal antibodies against CDC37 are available for use in various immunoassays. With its high viscosity and potent inhibitory properties, the CDC37 antibody is an essential tool for scientists studying growth factor-related processes.</p>

<p>ACOT2 antibody was raised using the middle region of ACOT2 corresponding to a region with amino acids SPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MPP5 antibody, catalog no. 70R-3081</p>

<p>Troponin I antibody was raised in mouse using human troponin I as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SF1 antibody, catalog no. 70R-1476</p>

<p>Affinity purified Rabbit polyclonal Proteasome 20S alpha 2 antibody</p>

<p>Desipramine Conjugate for use in immunoassays</p>

<p>Mouse monoclonal MPP3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC22A2 antibody, catalog no. 70R-1735</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MCM10 antibody, catalog no. 70R-5512</p>

<p>Purified Guinea Pig IgG FITC conjugate</p>

<p>Mouse monoclonal KLHL2 antibody</p>

<p>PSA antibody (HRP) was raised in mouse using highly pure human PSA as the immunogen.</p>

<p>Purified recombinant ACY3 protein</p>

<p>NDC80 antibody was raised in Rabbit using Human NDC80 as the immunogen</p>

<p>25-153 amino acids: MGSSHHHHHH SSGLVPRGSH MHKCDITLQE IIKTLNSLTE QKTLCTELTV TDIFAASKNT TEKETFCRAA TVLRQFYSHH EKDTRCLGAT AQQFHRHKQL IRFLKRLDRN LWGLAGLNSC PVKEANQSTL ENFLERLKTI MREKYSKCSS</p>

<p>Closantel chemical reference substance</p>

<p>The MARCKS antibody is a highly specialized protein kinase that plays a crucial role in various cellular processes. It is activated by β-catenin and has been shown to have anti-glial fibrillary acidic properties. This antibody can be used for research purposes, as it can specifically bind to the target protein and inhibit its activity. The MARCKS antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the option that best suits their needs. Additionally, this antibody has been tested on liver microsomes and has shown promising results. With its high specificity and reactivity, the MARCKS antibody is a valuable tool for studying cellular pathways and developing targeted therapies.</p>

<p>Tmem184b antibody was raised in rabbit using the middle region of Tmem184b as the immunogen</p>

<p>Purified recombinant Human RAB7A protein</p>

<p>Rabbit polyclonal COX6A1 antibody</p>

<p>Mouse monoclonal PACSIN3 antibody</p>

<p>Purified recombinant CBX1 protein</p>

<p>The JAK1 antibody is a highly specialized growth factor that binds to specific receptors in the body. It belongs to the class of antibodies known as colloidal antibodies, which have unique properties that enhance their efficacy. With its high viscosity and acetyltransferase activity, the JAK1 antibody is widely used in Life Sciences research for its cytotoxic effects on target cells.</p>

<p>Mouse monoclonal NXNL2 antibody</p>

<p>The CCR7 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to target and bind to the activated form of CCR7, a chemokine receptor involved in immune cell migration. This antibody is derived from human serum and is widely used for research purposes.</p>

<p>The KLH antibody is a highly specialized protein that plays a crucial role in various biological processes. It is an essential component of the transferrin and DNA aptamer systems, which are responsible for transporting molecules and regulating gene expression, respectively. Additionally, the KLH antibody has been shown to interact with TGF-β1, a key signaling molecule involved in cell growth and differentiation.</p>

<p>Mouse monoclonal STAT4 antibody</p>

<p>HIV1 p24 antibody was raised in goat using purified native p24 from strain IIIB as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDIA6 antibody, catalog no. 70R-5434</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GJC1 antibody, catalog no. 70R-1696</p>

<p>Recombinant Human KLK13 protein (His tag)</p>

<p>RB antibody was raised in Mouse using a purified recombinant fragment of human RB expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal CD225 antibody (HRP)</p>

<p>The Emerin Antibody is a highly specialized product used in the field of Life Sciences. This antibody is designed to target and neutralize dopamine, a neurotransmitter involved in various physiological processes. By specifically binding to dopamine, the Emerin Antibody prevents its activation and subsequent effects on neuronal signaling.</p>

<p>Affinity purified Rabbit polyclonal FGD4 antibody</p>

<p>VGLL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY</p>

<p>The BIRC5 antibody is a monoclonal antibody that targets the myelin-associated glycoprotein. It has been shown to have a high affinity for interferon-gamma (IFN-gamma), a glycoprotein involved in immune response regulation. This antibody is widely used in life sciences research and has applications in various fields such as immunology, oncology, and neuroscience.</p>

<p>Purified recombinant HBG1 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARF1 antibody, catalog no. 70R-8783</p>

<p>Rabbit polyclonal CXCL1 antibody (HRP)</p>

<p>Rabbit polyclonal NOX3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM55 antibody, catalog no. 70R-2754</p>

<p>Adenovirus antibody was raised in rabbit using residues 255-264 [CYYKASDGAL] of the fiber knob protein of Ad 3 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM59 antibody, catalog no. 70R-1779</p>

<p>ERGIC2 antibody was raised in Rabbit using Human ERGIC2 as the immunogen</p>

<p>CD51 antibody was raised in rabbit using a synthetic protein corresponding to residues 1022-1034 of the human alpha V integrin subunit as the immunogen.</p>

<p>PSA antibody was raised in Mouse using human PSA as the immunogen.</p>

<p>KLHL9 antibody was raised using a synthetic peptide corresponding to a region with amino acids SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY</p>

<p>TMEM163 antibody was raised using the middle region of TMEM163 corresponding to a region with amino acids AAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSV</p>

<p>Purified recombinant Human ARF4 protein</p>

<p>Keratin K15 antibody was raised in Guinea Pig using C-terminal tail region (including parts of the rod domain) of human recombinant keratin K15 as the immunogen.</p>

<p>Rabbit polyclonal PITPNB antibody</p>

<p>TJAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTSAAPAKKPYRKAPPEHRELRLEIPGSRLEQEEPLTDAERMKLLQEENE</p>

<p>Region of Cardiotrophin 1 protein corresponding to amino acids MSRREGSLED PQTDSSVSLL PHLEAKIRQT HSLAHLLTKY AEQLLQEYVQ LQGDPFGLPS FSPPRLPVAG LSAPAPSHAG LPVHERLRLD AAALAALPPL LDAVCRRQAE LNPRAPRLLR RLEDAARQAR ALGAAVEALL AALGAANRGP RAEPPAATAS AASATGVFPA KVLGLRVCGL YREWLSRTEG DLGQLLPGGS A.</p>

<p>Purified Rabbit polyclonal MPHOSPH9 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Extensive research has demonstrated its high efficacy using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations, making it highly versatile in combating tuberculosis. With its ability to bind to specific markers expressed in Mycobacterium tuberculosis strains, it effectively inhibits cell growth in culture.</p>

<p>Rabbit polyclonal Actin alpha 2/3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf130 antibody, catalog no. 70R-1154</p>

<p>Rabbit Polyclonal Estrogen Receptor alpha antibody (Ser106)</p>

<p>Rabbit anti-sheep IgG (biotin) was raised in rabbit using sheep IgG F(ab')2 fragment as the immunogen.</p>

<p>SEPN1 antibody was raised in rabbit using the C terminal of SEPN1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMED8 antibody, catalog no. 70R-3834</p>

<p>TC2N antibody was raised using the middle region of TC2N corresponding to a region with amino acids SWPSSYGDTPTVSIKGILTLPKPVHFKSSAKEGSNAIEFMETFVFAIKLQ</p>

<p>Rabbit polyclonal ZNF266 antibody</p>

<p>Rabbit polyclonal TAF7 antibody</p>