Biochemicals and Reagents

<p>OGG1 antibody was raised in rabbit using the C terminal of OGG1 as the immunogen</p>

<p>Purified recombinant Human EPCAM protein (His tag)</p>

<p>COX6A1 antibody was raised in Rabbit using Human COX6A1 as the immunogen</p>

<p>Rabbit polyclonal OCIAD1 antibody</p>

<p>Keratin K6 antibody was raised in Guinea Pig using synthetic peptide of human keratin K6 coupled to KLH as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZFP287 antibody, catalog no. 20R-1161</p>

<p>NARF antibody was raised in rabbit using the middle region of NARF as the immunogen</p>

<p>NT3 antibody was raised in goat using highly pure recombinant human NT-3 as the immunogen.</p>

<p>UCHL5 antibody was raised in rabbit using the middle region of UCHL5 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CRYBA1 antibody, catalog no. 70R-2029</p>

<p>GABRA3 antibody was raised in Rabbit using Human GABRA3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BRWD1 antibody, catalog no. 70R-2548</p>

<p>The STAT3 antibody is a powerful tool used in life sciences research to study the function and activity of the transcription factor STAT3. This antibody specifically recognizes and binds to the phosphorylated form of STAT3, allowing researchers to investigate its role in various cellular processes. The chromatin immunoprecipitation assay can be performed using this antibody to analyze the DNA binding activity of STAT3 and identify its target genes. Additionally, the STAT3 antibody has been shown to inhibit the growth factor-induced transmembrane conductance in certain cell types. It has also been implicated in neuroprotective effects and plays a crucial role in the regulation of cytokine family signaling pathways, such as interleukin-6. With its high specificity and potency, this polyclonal antibody is an essential tool for scientists studying signal transduction pathways mediated by STAT3.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MTTP antibody, catalog no. 70R-7339</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of COCH antibody, catalog no. 70R-9822</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2E2 antibody, catalog no. 70R-2819</p>

<p>PPP3CA antibody was raised using a synthetic peptide corresponding to a region with amino acids LPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINE</p>

<p>Rabbit polyclonal OR10Z1 antibody</p>

<p>Purified Polyclonal RIT1 antibody</p>

<p>Helicobacter pylori antibody (FITC) was raised in rabbit using ATCC strain 43504 as the immunogen.</p>

<p>Rabbit polyclonal AKAP14 antibody</p>

<p>HSPA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV</p>

<p>Cardiotrophin 1 antibody was raised in rabbit using highly purerecombinant hCT-1 (human Cardiotrophin-1) as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GFPT2 antibody, catalog no. 70R-8530</p>

<p>E2F8 antibody was raised in Rabbit using Human E2F8 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GAS8 antibody, catalog no. 70R-3968</p>

<p>Rabbit polyclonal NUF2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAP3K14 antibody, catalog no. 70R-3485</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAP1GDS1 antibody, catalog no. 70R-9838</p>

<p>Rabbit anti-human IgG (Rhodamine) was raised in rabbit using human IgG F(ab')2 fragment as the immunogen.</p>

<p>Hantavirus antibody was raised in mouse using recombinant puumala nucleocaspid protein as the immunogen.</p>

<p>The CXCR2 antibody is a highly effective tool used in the field of life sciences. It is a glycoprotein that specifically targets and binds to the CXCR2 receptor, which plays a crucial role in various cellular processes such as endothelial growth and chemokine signaling. This antibody is widely used in research settings to study the function of CXCR2 and its involvement in different biological pathways.</p>

<p>Affinity purified Rabbit polyclonal FBXL12 antibody</p>

<p>The RhoH antibody is a polyclonal antibody that is specifically designed to target and bind to RhoH, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting RhoH in different samples.</p>

<p>The ApoD antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is produced by hybridoma cells and has been widely used in the field of Life Sciences for research purposes. This monoclonal antibody has shown to effectively neutralize TNF-α, which plays a crucial role in inflammation and immune response. In addition to TNF-α, the ApoD antibody also targets other cytokines such as interleukin-6 (IL-6) and leukemia inhibitory factor (LIF). The binding of this antibody to its target molecules can modulate various cellular processes including transmembrane conductance, epidermal growth factor signaling, and oncogenic kinase activity. With its high specificity and affinity, the ApoD antibody is a valuable tool for researchers studying these pathways and exploring potential therapeutic applications. Additionally, polyclonal antibodies against ApoD are also available for researchers who require a broader range of epitope recognition.</p>

<p>C1orf96 antibody was raised using the middle region of C1orf96 corresponding to a region with amino acids ENKHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEK</p>

<p>Rabbit polyclonal EXTL3 antibody (HRP)</p>

<p>Rabbit polyclonal MPZ antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD11 antibody, catalog no. 70R-1491</p>

<p>Purified recombinant Human MYL12B Protein (His tag)</p>

<p>TCEAL8 antibody was raised in rabbit using the middle region of TCEAL8 as the immunogen</p>

<p>Rabbit polyclonal NFKB p105 antibody</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNH6 antibody, catalog no. 70R-5116</p>

<p>Atp5d antibody was raised in rabbit using the C terminal of Atp5d as the immunogen</p>

<p>ARL15 antibody was raised in Rabbit using Human ARL15 as the immunogen</p>

<p>PSMA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK</p>

<p>ACAD8 antibody was raised in Rabbit using Human ACAD8 as the immunogen</p>

<p>Rabbit polyclonal Glucokinase Regulator antibody</p>

<p>Recombinant Human NT5C3B protein</p>

<p>RAD51L3 antibody was raised in rabbit using the C terminal of RAD51L3 as the immunogen</p>

<p>CD48 antibody was raised in Rabbit using Human CD48 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATPAF1 antibody, catalog no. 70R-9517</p>

<p>Purified Polyclonal CABP5 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCND2 antibody, catalog no. 70R-5109</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF259 antibody, catalog no. 70R-8255</p>

<p>DNM1 antibody was raised in Rabbit using Human DNM1 as the immunogen</p>

<p>Resistin antibody (biotin) was raised in goat using highly pure recombinant murine resistin as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ASF1A antibody, catalog no. 70R-9597</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACAT2 antibody, catalog no. 70R-1083</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC339977 antibody, catalog no. 70R-6659</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FN1 antibody, catalog no. 70R-6082</p>

<p>Synaptojanin 1 antibody was raised using the middle region of SYNJ1 corresponding to a region with amino acids PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP</p>

<p>RBMS3 antibody was raised using the middle region of RBMS3 corresponding to a region with amino acids PTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK</p>

<p>NDUFA9 antibody was raised in Rabbit using Human NDUFA9 as the immunogen</p>

<p>GSTM5 antibody was raised in Rabbit using Human GSTM5 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LMF2 antibody, catalog no. 70R-6271</p>

<p>Affinity purified Rabbit polyclonal C1orf165 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADH1B antibody, catalog no. 70R-3920</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALKBH8 antibody, catalog no. 70R-5009</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NT5C1B antibody, catalog no. 70R-4405</p>

<p>EEFSEC antibody was raised in Rabbit using Human EEFSEC as the immunogen</p>

<p>The STAT3 antibody is a powerful tool used in Life Sciences research. It is designed to specifically target and bind to the STAT3 protein, which plays a crucial role in cell signaling and gene expression. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>The SERPINB13 antibody is a highly effective anti-HER2 monoclonal antibody. It belongs to the class of monoclonal antibodies and specifically targets HER2, a protein that is overexpressed in certain types of cancer cells. By binding to HER2, this antibody inhibits its activity and prevents the growth and spread of cancer cells.</p>

<p>Rabbit polyclonal NUDT6 antibody</p>

<p>KCNIP3 antibody was raised in Rabbit using Human KCNIP3 as the immunogen</p>

<p>Rabbit polyclonal PIGO antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SNTB1 antibody, catalog no. 70R-6691</p>

<p>Influenza A antibody (H3N2) (biotin) was raised in goat using influenza A, strain Texas 1/77 (H3N2) as the immunogen.</p>

<p>DRD2 antibody was raised in Rabbit using Human DRD2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GRIP1 antibody, catalog no. 70R-7931</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PARN antibody, catalog no. 20R-1155</p>

<p>Rabbit polyclonal NFKP p105/p50 antibody</p>

<p>Purified Polyclonal SIX3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RCC2 antibody, catalog no. 70R-3169</p>

<p>CTAGE1 antibody was raised in Rabbit using Human CTAGE1 as the immunogen</p>

<p>Feline (Cat) IgG Purified-Protein A</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNAB2 antibody, catalog no. 70R-1506</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PNRC1 antibody, catalog no. 70R-9156</p>

<p>ACOX2 antibody was raised in Rabbit using Human ACOX2 as the immunogen</p>

<p>Rabbit polyclonal MRPS18C antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C12orf49 antibody, catalog no. 70R-7355</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1627 antibody, catalog no. 70R-8960</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TUSC4 antibody, catalog no. 70R-8928</p>

<p>HSFY1 antibody was raised in rabbit using the N terminal of HSFY1 as the immunogen</p>

<p>NR0B1 antibody was raised using the N terminal of NR0B1 corresponding to a region with amino acids  TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC</p>

<p>Purified Rabbit polyclonal M3K-R15 antibody</p>

<p>Rabbit anti-dog IgG (FITC) was raised in rabbit using canine IgG F(ab')2 fragment as the immunogen.</p>

<p>MYEF2 antibody was raised in Rabbit using Human MYEF2 as the immunogen</p>

<p>C Peptide antibody was raised in mouse using human C-peptide-BSA as the immunogen.</p>

<p>TAF13 antibody was raised in rabbit using the N terminal of TAF13 as the immunogen</p>

<p>Rabbit polyclonal COX4i1 antibody (Ser58)</p>

<p>The SERPINB2 antibody is a monoclonal antibody that is used in mass spectrometric methods to detect and study inhibitors of serine proteases. It specifically targets SERPINB2, a protein complex involved in regulating the activity of serine proteases. This antibody can be used in various life sciences research applications, including the study of nuclear extracts and the detection of autoantibodies. Additionally, it has been shown to inhibit the growth factor signaling pathway and act as a kinase inhibitor. The SERPINB2 antibody is a valuable tool for researchers in the field of protein analysis and characterization.</p>

<p>ENTPD4 antibody was raised in Rabbit using Human ENTPD4 as the immunogen</p>

<p>Recombinant human POLB protein</p>

<p>Rabbit Polyclonal cJun antibody</p>

<p>Rabbit polyclonal CNTF antibody (biotin)</p>

<p>Rabbit polyclonal PANK3 antibody</p>

<p>MLF1IP antibody was raised in Rabbit using Human MLF1IP as the immunogen</p>

<p>1-186 amino acids: MTEYKLVVVG AGGVGKSALT IQLIQNHFVD EYDPTIEDSY RKQVVIDGET CLLDILDTAG QEEYSAMRDQ YMRTGEGFLC VFAINNTKSF EDIHQYREQI KRVKDSDDVP MVLVGNKCDL AARTVESRQA QDLARSYGIP YIETSAKTRQ GVEDAFYTLV REIRQHKLRK LNPPDESGPG CMSCKCLEHH HHHH</p>

<p>AMY2B antibody was raised in rabbit using the N terminal of AMY2B as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RIOK2 antibody, catalog no. 70R-3723</p>

<p>Recombinant human IDH3G protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ARL8A antibody, catalog no. 70R-5793</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POLR3F antibody, catalog no. 70R-2038</p>

<p>Rabbit polyclonal PSMB6 antibody</p>

<p>Borrelia burgdorferi Ab is an amide that acts as a chemokine in the human body. It has been extensively studied in Life Sciences for its role in various processes. This compound has shown to be nephrotoxic and can be detected in human serum using Monoclonal Antibodies. Borrelia burgdorferi Ab has also been associated with the production of autoantibodies and the regulation of TGF-beta. Furthermore, it has shown cytotoxic effects on certain cells and has been studied for its potential therapeutic applications. The use of monoclonal antibodies targeting Borrelia burgdorferi Ab has shown promising results in research studies, indicating its potential as a diagnostic tool or therapeutic agent.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EPX antibody, catalog no. 70R-5444</p>

<p>Recombinant human RAB2B protein (His tag)</p>

<p>Estradiol-OVA conjugate</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GALNAC4S-6ST antibody, catalog no. 70R-5944</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PARP10 antibody, catalog no. 70R-8550</p>

<p>Rabbit polyclonal TNF14 antibody</p>

<p>Rabbit polyclonal PLD2 antibody (Tyr169)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SSB antibody, catalog no. 70R-4891</p>

<p>Purified recombinant TNFSF11 protein</p>

<p>CEP70 antibody was raised in Rabbit using Human CEP70 as the immunogen</p>

<p>Rabbit polyclonal CDH15 antibody</p>

<p>Rabbit polyclonal TRIP4 antibody</p>

<p>The p53 antibody is a highly specialized product used in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, offering researchers a range of options for their experiments. These antibodies are designed to specifically target the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF8 antibody, catalog no. 20R-1245</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLDN7 antibody, catalog no. 70R-6156</p>

<p>Rabbit anti-goat IgG (H + L) (Alk Phos) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Gm5581 antibody, catalog no. 70R-9561</p>

<p>The COX2 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It specifically targets the cyclooxygenase-2 enzyme (COX2), which plays a crucial role in inflammation and pain. This antibody has been extensively studied and validated for its high specificity and sensitivity in detecting COX2 expression.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RIOK3 antibody, catalog no. 70R-5631</p>

<p>The RSV Antibody is a highly effective antiviral treatment that utilizes monoclonal antibodies to combat respiratory syncytial virus (RSV) infections. These antibodies specifically target and neutralize the virus, preventing it from infecting healthy cells and spreading throughout the body.</p>

<p>Rabbit Polyclonal HSP27 antibody (Ser15)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LRRTM4 antibody, catalog no. 70R-7442</p>

<p>COX18 antibody was raised using a synthetic peptide corresponding to a region with amino acids  LCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISR</p>

<p>The p27Kip1 antibody is a highly specialized product used in Life Sciences research. It is an essential tool for studying the role of p27Kip1, a protein involved in cell cycle regulation and tumor suppression. This polyclonal antibody is designed to specifically bind to p27Kip1 and can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry.</p>

<p>The p53 antibody is a highly specialized antibody that plays a crucial role in neutralizing the activity of p53, a protein known for its tumor-suppressing properties. This antibody acts as an inhibitor, preventing the binding of p53 to its target molecules and thus inhibiting its function.</p>

<p>The FGF9 antibody is a highly effective monoclonal antibody that targets the acidic protein caspase-9. It has potent antiviral properties and has been shown to inhibit the activity of p38 MAPK, a key enzyme involved in cellular signaling pathways. This antibody specifically binds to nuclear factor kappa-light-chain-enhancer and β-catenin, preventing their activation and subsequent gene expression. Additionally, it has been found to have endonuclease activity, which can lead to DNA fragmentation and cell death in targeted cells. The FGF9 antibody is widely used in life sciences research, particularly in studies involving Mycoplasma genitalium. It is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs. With its ability to inhibit polymerase activity and modulate p38 mitogen-activated protein signaling, this antibody offers great potential for various applications in the field of protein research.</p>

<p>Rabbit polyclonal CIB3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATF5 antibody, catalog no. 70R-9569</p>

<p>FUBP3 antibody was raised in rabbit using the N terminal of FUBP3 as the immunogen</p>

<p>1-222 amino acids: MGSSHHHHHH SSGLVPRGSH MDLLFGRRKT PEELLRQNQR ALNRAMRELD RERQKLETQE KKIIADIKKM AKQGQMDAVR IMAKDLVRTR RYVRKFVLMR ANIQAVSLKI QTLKSNNSMA QAMKGVTKAM GTMNRQLKLP QIQKIMMEFE RQAEIMDMKE EMMNDAIDDA MGDEEDEEES DAVVSQVLDE LGLSLTDELS NLPSTGGSLS VAAGGKKAEA AASALADADA DLEERLKNLR RD</p>

<p>Purified recombinant Human ALDOC protein</p>

<p>The MDM4 antibody is a highly specialized monoclonal antibody that targets the growth factor MDM4. This antibody has been shown to be effective in inhibiting the activity of MDM4, which plays a crucial role in adipose tissue development. By binding to MDM4, the antibody prevents its activation and subsequent signaling pathways involved in adipogenesis. Additionally, this monoclonal antibody has been found to interact with histidine residues on MDM4, further enhancing its neutralizing effect.</p>

<p>Purified Mouse IgG (Fab) FITC conjugate</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SFXN1 antibody, catalog no. 70R-6522</p>

<p>Rabbit IgG (H + L) purified protein</p>

<p>Rabbit polyclonal PA2G4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SSB antibody, catalog no. 70R-1427</p>

<p>CD5 antibody (FITC) was raised in mouse using feline CD5 as the immunogen.</p>

<p>ABHD5 antibody was raised using the C terminal of ABHD5 corresponding to a region with amino acids SVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQK</p>

<p>SF3A1 antibody was raised using the N terminal of SF3A1 corresponding to a region with amino acids RQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQ</p>

<p>This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.</p>

<p>The Phosphotyrosine antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically recognize and bind to phosphorylated tyrosine residues on proteins, making it an essential tool for studying kinase substrates and phosphatase activity. This antibody is particularly useful in investigating signaling pathways involving tyrosine kinase receptors, such as the epidermal growth factor receptor or colony-stimulating factor receptor.</p>

<p>KCNH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRMPHLAVATDKTLAPSSEQEQPEGLWPPLASPLHPLEVQGLICGPCFSS</p>

<p>Rabbit polyclonal ZNF24 antibody</p>

<p>The Fentanyl Antibody is a highly specialized product used in Life Sciences research. It is designed to detect and quantify fentanyl, a potent synthetic opioid, in various samples. The antibody is immobilized on magnetic particles, allowing for easy separation and purification of fentanyl from complex matrices. This product is commonly used in immunoassays, where it can be utilized for the development of diagnostic tests or screening assays.</p>

<p>Rabbit polyclonal IL1RA antibody (FITC)</p>

<p>Pigeon Serum Albumin is a versatile protein that has various applications in the field of Life Sciences. It is known for its proteolytic activity and its ability to promote hepatocyte growth. Pigeon Serum Albumin can be used in electrophoresis studies to separate and analyze proteins based on their charge and size. Additionally, it has been used as an antigen in DNA vaccine development and in the culture of pluripotent stem cells.</p>

<p>NDUFA6 antibody was raised in Rabbit using Human NDUFA6 as the immunogen</p>

<p>CREB3 antibody was raised in Rabbit using Human CREB3 as the immunogen</p>

<p>Histamine-OVA is a monoclonal antibody that belongs to the field of Life Sciences. It acts as a growth factor and has neutralizing properties. This antibody has been extensively studied in various experiments, including its interaction with liver microsomes and ovalbumin. It has also been shown to modulate the production of interferon and other cytokines. Histamine-OVA is known for its ability to bind to specific receptors, such as cation channels and retinoid receptors, leading to downstream signaling events. Additionally, this antibody can be conjugated with haptens or streptavidin for various applications in research and diagnostics. Overall, Histamine-OVA is a versatile tool in the field of Life Sciences with potential applications in immunology, cell biology, and molecular biology research.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of POLR3GL antibody, catalog no. 70R-10078</p>

<p>The Synaptophysin antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets synaptophysin, a protein that plays a crucial role in synaptic vesicle trafficking and neurotransmitter release. It is widely used in studies involving growth factors, mesenchymal stem cells, lysine emission, autoantibodies, monoclonal antibodies, and endothelial growth.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERAC1 antibody, catalog no. 70R-10152</p>

<p>The Transglutaminase 2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to transglutaminase 2, an enzyme that plays a crucial role in various biological processes. This antibody has been extensively tested and proven to be reactive against transglutaminase 2 in a variety of bioassays.</p>

<p>NHLRC1 antibody was raised in Rabbit using Human NHLRC1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Gabarapl2 antibody, catalog no. 70R-9176</p>

<p>Dopamine transporter antibody was raised in rabbit using an 18 amino acid peptide of rat DAT conjugated to KLH. as the immunogen.</p>

<p>This antibody reacts with heavy chains on human IgM (mu chain).</p>

<p>OPA3 antibody was raised in rabbit using the C terminal of OPA3 as the immunogen</p>

<p>Keratin K8 antibody was raised in Mouse using a purified recombinant fragment of human Cytokeratin (aa391-483) expressed in E. coli as the immunogen.</p>

<p>The CHAT antibody is a polyclonal antibody that specifically targets the choline acetyltransferase (CHAT) enzyme. CHAT is responsible for the synthesis of acetylcholine, a neurotransmitter involved in cholinergic signaling. This antibody is widely used in life sciences research to study the role of cholinergic signaling in various biological processes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUDCD3 antibody, catalog no. 70R-3285</p>

<p>MGEA5 antibody was raised in Rabbit using Human MGEA5 as the immunogen</p>