Biochemicals and Reagents

<p>alpha Synuclein antibody was raised in Mouse using a purified recombinant fragment of SNCA expressed in E. coli as the immunogen.</p>

<p>CDKN1B antibody was raised in Mouse using a purified recombinant fragment of human CDKN1B expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SMYD2 antibody, catalog no. 70R-8792</p>

<p>Recombinant Human ARHGEF39 protein</p>

<p>Mouse monoclonal FCGR2A antibody</p>

<p>The ADORA2A antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets the adenosine A2A receptor (ADORA2A), which plays a crucial role in various physiological processes, including the regulation of interleukin production and nuclear signaling. This antibody has been extensively studied and validated for its specificity and efficacy.</p>

<p>TRIM34 antibody was raised in rabbit using the N terminal of TRIM34 as the immunogen</p>

<p>PGM1 protein is an EGF-like protein that exhibits growth factor activity. It has been shown to promote the growth and differentiation of hepatocyte-like cells. Monoclonal antibodies specific to PGM1 have been developed and can be used for various applications, including hybridization assays and radionuclide imaging. These antibodies have neutralizing properties, which means they can inhibit the biological activity of PGM1. In addition, PGM1 has been found to have a stimulatory effect on TGF-beta signaling pathway and collagen production in liver microsomes. Overall, PGM1 protein plays a crucial role in cellular growth and tissue development.</p>

<p>The TAP antibody is a polyclonal antibody that is used in the field of life sciences. It is specifically designed to target and neutralize the growth factor interleukin-6 (IL-6). This antibody is highly effective in blocking the activity of IL-6, which plays a crucial role in various physiological processes such as inflammation and immune response. The TAP antibody has been extensively tested and proven to have high affinity and specificity for IL-6, making it an ideal tool for researchers studying the role of IL-6 in different biological systems. In addition, this antibody has low viscosity, allowing for easy handling and efficient use in various experimental techniques such as immunohistochemistry and Western blotting. Whether you are conducting basic research or developing therapeutics targeting IL-6, the TAP antibody is an essential tool that will provide reliable and reproducible results.</p>

<p>MYST1 antibody was raised in Mouse using a purified recombinant fragment of human MYST1 expressed in E. coli as the immunogen.</p>

<p>Mn SOD antibody was raised in rabbit using native rat Mn SOD as the immunogen.</p>

<p>The SARS-CoV-2 spike protein is present on the outside of the virus particles and can bind to angiotensin-converting enzyme II (ACE2) present on the host cells. The C-terminal receptor binding domain (RBD) of the spike protein binds to the N-terminal peptidase M2 domain of ACE2. This receptor binding results in the internalisation of the virus-receptor complex and is, therefore the mechanism of entry of SARS-CoV-2 into host cells.The spike protein residues LITGRLQSL (996-1004) from C have been identified as a T-cell epitope with a predicted HLA restriction. Immune targeting of confirmed epitopes may potentially offer protection against SARS-CoV-2 and help the development of vaccines for long-lasting immunity.</p>

<p>The beta Amyloid antibody is a polyclonal antibody used in life sciences research. It specifically targets the beta amyloid protein, which plays a crucial role in the development of Alzheimer's disease. This antibody can be used for various applications such as immunohistochemistry and nuclear staining. By binding to the beta amyloid protein, this antibody helps researchers study its distribution and localization within cells and tissues. Additionally, it can be used as a potential medicament for targeting beta amyloid in therapeutic interventions. The beta Amyloid antibody is highly specific and exhibits strong affinity towards its target, making it an essential tool for studying the pathogenesis of Alzheimer's disease and developing novel treatment strategies.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PECI antibody, catalog no. 70R-2299</p>

<p>Purified recombinant NRIP3 protein (His tag)</p>

<p>DPP7 antibody was raised in Rabbit using Human DPP7 as the immunogen</p>

<p>Region of GCSF protein corresponding to amino acids TPLGPASSLP QSFLLKCLEQ VRKIQGDGAA LQEKLCATYK LCHPEELVLL GHSLGIPWAP LSSCPSQALQ LAGCLSQLHS GLFLYQGLLQ ALEGISPELG PTLDTLQLDV ADFATTIWQQ MEELGMAPAL QPTQGAMPAF ASAFQRRAGG VLVASHLQSF LEVSYRVLRH LAQP.</p>

<p>Kcnip3 antibody was raised in rabbit using the middle region of Kcnip3 as the immunogen</p>

<p>Mouse monoclonal SULT1C2 antibody</p>

<p>The alpha Tubulin antibody is a highly specialized diagnostic agent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is specifically designed to target and bind to alpha tubulin, a protein that plays a crucial role in cell division and intracellular transport. This antibody has been extensively tested and validated for its genotoxic activity, making it an essential tool for researchers studying various cellular processes.</p>

<p>Rabbit polyclonal DLG2 antibody</p>

<p>CCR8 antibody was raised in rabbit using the middle region of CCR8 as the immunogen</p>

<p>ZNF546 antibody was raised in rabbit using the N terminal of ZNF546 as the immunogen</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Full length human BCL10 immunogen, Mouse monoclonal BCL10 antibody, reactive to human</p>

<p>Rabbit polyclonal APBA3 antibody</p>

<p>Influenza A antibody was raised in mouse using Influenza A nucleoprotein as the immunogen.</p>

<p>ZAG antibody is a polyclonal antibody that specifically targets collagen, a protein found in various tissues of the body. It can be used for research purposes to study collagen-related diseases or as a diagnostic tool in detecting collagen abnormalities. Additionally, ZAG antibody has been shown to have neutralizing effects on chemokines and growth factors such as TGF-beta and epidermal growth factor. This makes it a valuable tool in studying the role of these molecules in various physiological processes. Furthermore, ZAG antibody can also be used in therapeutic applications as an inhibitor of certain proteins or as an adjunct treatment with other antibodies like trastuzumab. Its versatility and specificity make ZAG antibody an essential tool for researchers and healthcare professionals alike.</p>

<p>Chicken anti Human IgG secondary antibody (FITC)</p>

<p>Rabbit polyclonal ZNF643 antibody</p>

<p>Rabbit polyclonal RAB1B antibody</p>

<p>The MCM3 antibody is a monoclonal antibody that specifically targets the growth factor MCM3. It acts as a neutralizing agent, inhibiting the activity of MCM3 and preventing its activation. This antibody has been widely used in Life Sciences research, particularly in studies involving trastuzumab, an anti-HER2 antibody. By blocking the interaction between MCM3 and epidermal growth factor receptors, this antibody effectively disrupts signaling pathways involved in cell growth and proliferation.</p>

<p>KCNQ4 antibody was raised using the middle region of KCNQ4 corresponding to a region with amino acids SSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQ</p>

<p>The Usp10 Blocking Peptide is a valuable tool in Life Sciences research. It belongs to the family of Blocking Peptides and is widely used in various experimental techniques. This peptide acts as an inhibitor of annexin, a protein involved in cell signaling pathways. By blocking the activity of annexin, researchers can gain insights into its role in different cellular processes.</p>

<p>NAT12 antibody was raised using the middle region of NAT12 corresponding to a region with amino acids EQVRLLSSSLTADCSLRSPSGREVEPGEDRTIRYVRYESELQMPDIMRLI</p>

<p>Purified recombinant ARL5B protein</p>

<p>AOC2 antibody (retina specific) was raised using a synthetic peptide corresponding to a region with amino acids AEDIPNTVTLGNRVGFLLRPYNFFDEDPSIFSPGSVYFEKGQDAGLCSIN</p>

<p>HYAL1 antibody was raised in rabbit using the N terminal of HYAL1 as the immunogen</p>

<p>Rabbit polyclonal AFX antibody</p>

<p>MSVSEIQLMH NLGKHLNSME RVEWLRKKLQ DVHNFVALGA PLAPRDAGSQ RPRKKEDNVL VESHEKSLGE ADKADVNVLT KAKSQ</p>

<p>FBXO10 antibody was raised using the middle region of FBXO10 corresponding to a region with amino acids SSSPKPGSKAGSQEAEVGSDGERVAQTPDSSDGGLSPSGEDEDEDQLMYR</p>

<p>Mouse monoclonal HMOX2 antibody</p>

<p>Rabbit polyclonal TBCA antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPX4 antibody, catalog no. 70R-2447</p>

<p>SLC17A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIYDDPMHHPCISVREKEHILSSLAQQPSSPGRAVPIKAMVTCLPLWAIF</p>

<p>VIP antibody was raised in rabbit using porcine VIP as the immunogen.</p>

<p>Rabbit polyclonal IL1b antibody (biotin)</p>

<p>The TSP1 antibody is a powerful tool used in Life Sciences. It is an antibody that specifically targets and binds to fibrinogen, a glycoprotein involved in blood clotting. This polyclonal antibody can be used in various applications, such as immunohistochemistry and Western blotting, to detect and quantify the presence of fibrinogen in biological samples. Additionally, the TSP1 antibody has been shown to have cytotoxic effects on cells expressing TNF-related apoptosis-inducing ligand (TRAIL), making it a valuable tool for studying cell death pathways. This monoclonal antibody has also been used in combination with other inhibitors, such as adalimumab, to block the activity of TNF-α, a key mediator of inflammation. With its high specificity and versatility, the TSP1 antibody is an essential component for any researcher working in the field of Life Sciences.</p>

<p>Recombinant Human CDK1 protein</p>

<p>Goat anti-human IgG was raised in goat using human IgG F(ab')2 fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NTF5 antibody, catalog no. 70R-6217</p>

<p>DPP8 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>B4GALT3 antibody was raised using the middle region of B4GALT3 corresponding to a region with amino acids MVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTN</p>

<p>UBE3A antibody was raised using the middle region of Ube3A corresponding to a region with amino acids AKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML</p>

<p>CRYM antibody was raised in Rabbit using Human CRYM as the immunogen</p>

<p>10-Formylfolic Acid (USP grade powder) chemical reference substance</p>

<p>1-152 amino acids: MGSSHHHHHH SSGLVPRGSH MKSPDEVLRE GELEKRSDSL FQLWKKKRGV LTSDRLSLFP ASPRARPKEL RFHSILKVDC VERTGKYVYF TIVTTDHKEI DFRCAGESCW NAAIALALID FQNRRALQDF RSRQERTAPA APAEDAVAAA AAAPSEPSEP SRPSPQPKPR TP</p>

<p>The DGKA antibody is a monoclonal antibody that specifically targets the activated form of alpha-synuclein, a protein kinase involved in various cellular processes. This monoclonal antibody has been shown to exhibit cytotoxic effects on cells expressing high levels of activated alpha-synuclein. In the field of Life Sciences, this antibody is widely used for research purposes, particularly in the study of mitogen-activated protein pathways and as a tool for investigating potential therapeutic strategies. Additionally, the DGKA antibody has been found to have inhibitory effects on tyrosine kinases and nuclear proteins. With its high specificity and affinity, this antibody is an invaluable tool for scientists working in the field of protein research and drug discovery.</p>

<p>SLC7A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAFFIGWNLILEYLIGTAAGASALSSMFDSLANHTISRWMADSVGTLNGL</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and heavy (mu) chains on mouse IgM and light chains on all mouse immunoglobulins.</p>

<p>AHSG antibody was raised in Rabbit using Human AHSG as the immunogen</p>

<p>The CCR4 antibody is a high-quality polyclonal antibody that is widely used in the field of Life Sciences. It specifically targets the colony-stimulating factor receptor 4 (CCR4), which plays a crucial role in cell growth and differentiation. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>Rabbit polyclonal RGS20 antibody</p>

<p>Complement C9 protein is a key component of the complement system, which is an important part of the immune response. It plays a crucial role in the formation of the membrane attack complex (MAC), which helps to destroy foreign invaders such as bacteria and viruses. Complement C9 protein works by forming pores in the cell membranes of these pathogens, leading to their destruction.</p>

<p>The SMAD3 antibody is a powerful tool in the field of molecular biology and immunology. It is a polyclonal antibody that specifically targets the SMAD3 protein, which plays a crucial role in various cellular processes such as chemokine signaling, multidrug resistance, and growth factor regulation. This antibody binds to the SMAD3 protein with high affinity and specificity, allowing researchers to study its function and interactions in different experimental settings.</p>

<p>BECN1 antibody was raised in Rabbit using Human BECN1 as the immunogen</p>

<p>Hspbp1 antibody was raised in rabbit using the C terminal of Hspbp1 as the immunogen</p>

<p>PNPT1 antibody was raised using the middle region of PNPT1 corresponding to a region with amino acids CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED</p>

<p>Rabbit polyclonal PLCZ1 antibody</p>

<p>Purified Polyclonal Pepsin A antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TTYH3 antibody, catalog no. 70R-8840</p>

<p>Rabbit polyclonal TSPAN5 antibody</p>

<p>Purified Rabbit polyclonal CSGALNACT1 antibody</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>Mouse monoclonal MRAS antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WDFY3 antibody, catalog no. 70R-9012</p>

<p>The FEN1 antibody is a highly specialized neutralizing agent that targets adeno-associated virus. It is widely used in the field of Life Sciences, particularly in research related to mcf-7 cells and tumor necrosis factor-alpha (TNF-α). This antibody is known for its ability to bind to fibronectin, which plays a crucial role in cell adhesion and migration. Additionally, the FEN1 antibody has been found to regulate viscosity and modulate the effects of epidermal growth factor (EGF) and other growth factors. It is available as both a monoclonal antibody and polyclonal antibodies, making it versatile for various experimental applications. Researchers also rely on this antibody to study multidrug resistance and endothelial growth. For unparalleled precision and reliability in your experiments, choose the FEN1 antibody.</p>

<p>KCNJ12 antibody was raised in Rabbit using Human KCNJ12 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal OSBPL2 antibody</p>

<p>Rabbit polyclonal RPA3 antibody (FITC)</p>

<p>The NMT2 antibody is a highly specialized antibody that targets activated atypical hemolytic cells. It has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the growth factor signaling pathway. The NMT2 antibody works by binding to epidermal growth factor receptors, preventing their activation and subsequent downstream signaling events. This inhibition leads to the dephosphorylation of key proteins involved in cell proliferation and survival, ultimately resulting in the suppression of tumor growth.</p>

<p>The ETNK2 antibody is a neuroprotective monoclonal antibody that has shown promising results in various studies. It has been found to promote the growth and survival of neurons and protect them from damage. This antibody specifically targets ETNK2, a protein involved in neuronal development and function.</p>

<p>Rabbit polyclonal RPL37 antibody</p>

<p>TYRO3 antibody was raised in Mouse using a purified recombinant fragment of Tyro3 (aa138-321) expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AHCYL1 antibody, catalog no. 70R-3883</p>

<p>Purified recombinant ST3GAL5 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DLG3 antibody, catalog no. 70R-6528</p>

<p>The CTNNB1 antibody is a highly potent monoclonal antibody that has shown promising results in the field of Life Sciences. It acts as an active agent by specifically targeting and binding to the CTNNB1 receptor, leading to cell lysis and inhibiting its signaling pathway. This antibody has been extensively studied for its ability to inhibit the growth of cancer cells and has shown potent antitumor activity in various preclinical models.</p>

<p>Donkey anti-goat IgG (rhodamine) was raised in donkey using goat IgG (H &amp; L) as the immunogen.</p>

<p>DHDDS antibody was raised using the N terminal of DHDDS corresponding to a region with amino acids NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR</p>

<p>ZNF565 antibody was raised in rabbit using the middle region of ZNF565 as the immunogen</p>

<p>Rabbit polyclonal NFKB p100 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM72 antibody, catalog no. 70R-2774</p>

<p>The S100A11 antibody is a polyclonal antibody that is used in Life Sciences research. It is specifically designed to neutralize the activity of S100A11 protein in human serum. This antibody is colloidal and activated, making it highly effective in cross-linking with other antibodies or proteins. The S100A11 antibody can be used in various applications, such as Western blotting, immunohistochemistry, and ELISA assays. It has been shown to effectively bind to the target protein complex and induce lysis of cells expressing high levels of S100A11. Additionally, this antibody has been found to have potential therapeutic applications due to its ability to inhibit the production of extracellular polysaccharides.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CAMKV antibody, catalog no. 70R-3638</p>

<p>Phosphoserine antibody (biotin) was raised in rabbit using KLH-phosphoserine conjugate as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ABCC9 antibody, catalog no. 70R-6250</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDS5A antibody, catalog no. 70R-3908</p>

<p>Rabbit polyclonal 53BP1 antibody (Ser6)</p>

<p>Lamin A Monoclonal Antibody (FITC)</p>

<p>LIMD2 antibody was raised in Rabbit using Human LIMD2 as the immunogen</p>

<p>Sheep polyclonal Mestanolone antibody</p>

<p>Androstenedione 3 Conjugate for use in immunoassays</p>

<p>The IpaD antibody is a basic protein that belongs to the family of nuclear antibodies. It is a growth factor that has egf-like properties, making it effective in inhibiting amyloid plaque formation. This antibody also plays a role in glycosylation and can bind to serum albumin protein. The IpaD antibody is a monoclonal antibody, which means it is highly specific and targets a specific antigen. It has phosphatase activity and can be found in human serum. This antibody may also have potential as an autoantibody for certain conditions.</p>

<p>HIV1 p24 antibody (FITC) was raised in goat using purified native p24 from strain IIIB as the immunogen.</p>

<p>The KRT8 antibody is a monoclonal antibody that specifically targets Keratin 8 (KRT8), a protein found in epithelial tissues. This antibody has been extensively studied and has shown promising results in various fields of research, particularly in the life sciences.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZXDC antibody, catalog no. 70R-8902</p>

<p>The NFkB p65 antibody is a highly specialized product in the field of Life Sciences. It is designed to detect and bind to the activated form of NFkB p65, a transcription factor involved in various cellular processes. This antibody is widely used in research and bioassays to study genotoxicity, inflammatory responses, and other related pathways.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBP2 antibody, catalog no. 70R-3389</p>

<p>Rabbit polyclonal CRYAB antibody (Ser59)</p>

<p>This antibody reacts with kappa light chains on human immunoglobulins.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDIA6 antibody, catalog no. 70R-5434</p>

<p>NKIRAS2 antibody was raised in Rabbit using Human NKIRAS2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf56 antibody, catalog no. 70R-6876</p>

<p>Purified Polyclonal XRCC2 antibody</p>

<p>RHOJ antibody was raised using the middle region of RHOJ corresponding to a region with amino acids LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK</p>

<p>The Beta catenin antibody is a highly specialized antibody used in Life Sciences research. It is a polyclonal antibody that specifically binds to β-catenin, a protein involved in cell adhesion and signaling pathways. This antibody has been extensively studied for its role in various cellular processes, including development, tissue homeostasis, and cancer progression.</p>

<p>1-543 amino acids: MGSSHHHHHH SSGLVPRGSH MEQVNELKEK GNKALSVGNI DDALQCYSEA IKLDPHNHVL YSNRSAAYAK KGDYQKAYED GCKTVDLKPD WGKGYSRKAA ALEFLNRFEE AKRTYEEGLK HEANNPQLKE GLQNMEARLA ERKFMNPFNM PNLYQKLESD PRTRTLLSDP TYRELIEQLR NKPSDLGTKL QDPRIMTTLS VLLGVDLGSM DEEEEIATPP PPPPPKKETK PEPMEEDLPE NKKQALKEKE LGNDAYKKKD FDTALKHYDK AKELDPTNMT YITNQAAVYF EKGDYNKCRE LCEKAIEVGR ENREDYRQIA KAYARIGNSY FKEEKYKDAI HFYNKSLAEH RTPDVLKKCQ QAEKILKEQE RLAYINPDLA LEEKNKGNEC FQKGDYPQAM KHYTEAIKRN PKDAKLYSNR AACYTKLLEF QLALKDCEEC IQLEPTFIKG YTRKAAALEA MKDYTKAMDV YQKALDLDSS CKEAADGYQR CMMAQYNRHD SPEDVKRRAM ADPEVQQIMS DPAMRLILEQ MQKDPQALSE HLKNPVIAQK IQKLMDVGLI AIR</p>

<p>The Lactoferrin antibody is a drug antibody that specifically targets the target molecule, Lactoferrin. It is a disulfide bond-containing antibody that has been shown to have high affinity and specificity for Lactoferrin. This antibody can be used in various applications in Life Sciences, such as research, diagnostics, and therapeutics. It has been extensively studied and validated for its ability to detect Lactoferrin in human serum samples using techniques like electrode-based immunoassays. The Lactoferrin antibody can also be used in immunohistochemistry and flow cytometry experiments to study the expression of Lactoferrin in different tissues and cell types. Its versatility and reliability make it an essential tool for researchers working on understanding the role of Lactoferrin in various biological processes.</p>

<p>The LPL antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of lipoprotein lipase (LPL), an enzyme involved in lipid metabolism. This antibody has been extensively studied for its potential therapeutic applications in various fields, including life sciences and ophthalmic formulations.</p>

<p>HRSP12 antibody was raised in Rabbit using Human HRSP12 as the immunogen</p>

<p>Rabbit polyclonal Kinase E28 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDZRN4 antibody, catalog no. 70R-2753</p>

<p>THOC1 antibody was raised using the C terminal of THOC1 corresponding to a region with amino acids TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES</p>

<p>Rabbit polyclonal PSMA8 antibody</p>

<p>Rabbit polyclonal ADRA1D antibody</p>

<p>Rabbit Polyclonal hnRNPC1 antibody</p>

<p>Rabbit polyclonal TrkA antibody (Tyr757)</p>

<p>DFFA antibody was raised in rabbit using the N terminal of DFFA as the immunogen</p>

<p>Recombinant Human OPTC protein (His tag)</p>

<p>Lamin antibody was raised in mouse using Nuclear pore complex-lamina fraction of Xenopus laevis (XLKEA6 cells) as the immunogen.</p>

<p>Dehydromethyltestosterone 3 Conjugate for use in immunoassays</p>

<p>Purified recombinant PPP1R3B protein (His tag)</p>

<p>The SLC39A8 antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets the SLC39A8 protein, which plays a crucial role in the transport of essential metals across cell membranes. This antibody can be used to study the function of SLC39A8 in various biological processes, including intercellular communication, metal homeostasis, and immune response.</p>

<p>Mouse monoclonal SulT1C2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNP1 antibody, catalog no. 70R-3172</p>

<p>The CD45RO antibody is a monoclonal antibody that specifically targets the CD45RO protein, which is expressed on activated T cells and memory T cells. This antibody has been extensively studied in the field of Life Sciences and has shown inhibitory effects on interleukin-6 (IL-6) signaling pathway and p38 MAPK activation. It has also been shown to inhibit syncytia formation, a process involved in viral infection.</p>

<p>CHTF18 antibody was raised using a synthetic peptide corresponding to a region with amino acids QALLLDALCLLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NPNT antibody, catalog no. 70R-2211</p>

<p>CD14 antibody is a potent inhibitor that targets the CD14 protein, which plays a crucial role in immune response. It can be used as a substrate for small interfering RNA (siRNA) experiments to study gene expression and function. CD14 antibody specifically binds to phosphorylcholine, an antigen found on various bacterial pathogens, and can be used in conjunction with other antibodies such as anti-CD33 antibody to identify specific cell populations. Additionally, CD14 antibody has been shown to inhibit the binding of autoantibodies to their target antigens, making it a valuable tool in autoimmune disease research. This antibody also has growth factor-like properties and has been used in Life Sciences research for its ability to promote cell proliferation and survival. CD14 antibody is available in colloidal form or as monoclonal antibodies conjugated to microspheres for easy detection and isolation of target cells. Its use in studies involving chemokines and tumor necrosis factor-alpha (TNF-α) further highlights its versatility</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CRYBB3 antibody, catalog no. 70R-2830</p>

<p>Rabbit polyclonal ENT1 antibody</p>

<p>Purified Polyclonal Cytokine IK antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. Through its mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through the use of advanced techniques like the patch-clamp technique on human erythrocytes. Metabolically, this drug undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>ZMYND11 antibody was raised in rabbit using the middle region of ZMYND11 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the rifamycins class. It is specifically designed to combat tuberculosis infections and contains active compounds with bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been proven through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPN2 antibody, catalog no. 70R-7330</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NOVA1 antibody, catalog no. 70R-5002</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IFI44L antibody, catalog no. 70R-1290</p>

<p>CASP10 antibody was raised in rabbit using the middle region of CASP10 as the immunogen</p>

<p>Rabbit polyclonal Integrin beta 3 antibody (Tyr785)</p>

<p>Mouse monoclonal Benzoylecgonine/Cocaine antibody</p>

<p>Mouse monoclonal NHEJ1 antibody</p>

<p>Rabbit polyclonal NPY5R antibody</p>

<p>Histone H3.1 antibody is a polyclonal antibody that specifically targets the histone protein H3.1. This antibody has been shown to have inhibitory effects on various proteins, including EGF-like inhibitors, chemokines, and epidermal growth factors. It also possesses neutralizing properties against TGF-beta and anti-ACTH antibodies. Additionally, this antibody has been found to interact with collagen and trastuzumab, a monoclonal antibody used in the treatment of certain types of cancer. The histone H3.1 antibody can be utilized in research studies to investigate the role of histones in gene regulation, cellular growth, and cytotoxicity.</p>

<p>Rabbit polyclonal PPFIA1 antibody</p>

<p>Rabbit polyclonal ARFGAP3 antibody</p>

<p>Rabbit polyclonal Ezrin antibody (Thr566)</p>

<p>Purified Rabbit polyclonal MPK13 antibody</p>

<p>Recombinant human RTN4IP1 protein (His tag)</p>

<p>The mGLUR5 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as an inhibitor, targeting the androgen receptor and exerting cytotoxic effects on specific cells. This antibody also has the ability to neutralize certain growth factors, interferons, hepatocyte growth factors, and chemokines. Additionally, it exhibits antiviral properties by targeting glycoproteins involved in viral replication. The mGLUR5 antibody is a versatile tool that can be utilized in various research applications, including multidrug resistance studies and electrode-based assays. Its high specificity and potency make it an invaluable asset for scientists working in diverse fields of study.</p>

<p>Purified recombinant CCDC104 protein (His tag)</p>

<p>Rabbit polyclonal RASD2 antibody</p>

<p>The SIRT6 antibody is a monoclonal antibody that is widely used in Life Sciences research. It specifically targets the protein SIRT6, which plays a crucial role in various cellular processes. This antibody is highly specific and has been extensively validated for its immunosuppressant properties.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GZMH antibody, catalog no. 70R-1596</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK3 antibody, catalog no. 70R-1536</p>

<p>The MYD88 antibody is a growth factor that is commonly used in immunoassays. It plays a crucial role in various cellular processes, including the activation of mitogen-activated protein kinases and endonucleases. The MYD88 antibody specifically targets the p38 mitogen-activated protein kinase (MAPK) pathway, which is involved in immune responses and inflammation. By immobilizing and activating this pathway, the MYD88 antibody enhances the polymerase activity and caspase-9 activation, leading to increased cell proliferation and apoptosis. This antibody is available as both polyclonal antibodies and monoclonal antibodies, allowing for versatile applications in research and diagnostics. Additionally, the MYD88 antibody has been shown to interact with nuclear factor kappa-light-chain-enhancer (NF-κB), further contributing to its immunomodulatory properties.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPL9 antibody, catalog no. 70R-1440</p>

<p>Rabbit polyclonal Transferrin antibody</p>

<p>Rabbit polyclonal ZNF256 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PROC antibody, catalog no. 70R-1597</p>

<p>Rabbit polyclonal PPP1R11 antibody (FITC)</p>

<p>HEY1 antibody was raised using the middle region of HEY1 corresponding to a region with amino acids HQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAF</p>

<p>Rabbit polyclonal AGP2 antibody (FITC)</p>

<p>RAD17 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLEKHA4 antibody, catalog no. 70R-3639</p>

<p>Rabbit Polyclonal Shc1 antibody (Tyr349)</p>

<p>114-281 amino acids: MVRERGPQRV AAHITGTRGR SNTLSSPNSK NEKALGRKIN SWESSRSGHS FLSNLHLRNG ELVIHEKGFY YIYSQTYFRF QEEIKENTKN DKQMVQYIYK YTSYPDPILL MKSARNSCWS KDAEYGLYSI YQGGIFELKE NDRIFVSVTN EHLIDMDHEA SFFGAFLVG</p>

<p>The NTR1 antibody is a polyclonal antibody that is commonly used in the field of Life Sciences. It is specifically designed to target and bind to NTR1, a protein that plays a crucial role in various biological processes. This antibody can be used for immobilization purposes, such as in immunoassays or for the detection of NTR1 in human serum samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SRPRB antibody, catalog no. 70R-1768</p>