Biochemicals and Reagents

<p>The AFP antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP) in human serum. It can be used in various applications, including research in Life Sciences and diagnostics. This antibody binds to AFP, a glycoprotein that is normally produced by the liver during fetal development but can also be present in certain types of cancer, such as hepatocellular carcinoma and germ cell tumors.</p>

<p>Mouse monoclonal GBP5 antibody</p>

<p>Rabbit polyclonal SMTNL2 antibody</p>

<p>Rabbit polyclonal CPN1 antibody</p>

<p>Mouse IgG1 antibody was raised in goat using mouse IgG1 in freunds adjuvant as the immunogen.</p>

<p>MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM</p>

<p>ANP32B antibody was raised using a synthetic peptide corresponding to a region with amino acids GLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAE</p>

<p>Sterile Rabbit Plasma with EDTA</p>

<p>ADA antibody was raised using the middle region of ADA corresponding to a region with amino acids ANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPE</p>

<p>Rabbit polyclonal AEG1 antibody</p>

<p>Purified recombinant Human SERTAD1 protein (His tag)</p>

<p>ZNF529 antibody was raised in rabbit using the middle region of ZNF529 as the immunogen</p>

<p>Rabbit polyclonal RINT1 antibody</p>

<p>The TIM3 antibody is a monoclonal antibody that targets the TIM-3 protein, which plays a crucial role in regulating immune responses. This antibody specifically recognizes and binds to the glycosylation site on the TIM-3 protein, inhibiting its function. By blocking the interaction between TIM-3 and its ligands, this antibody helps modulate immune responses and can be used for various applications in life sciences research.</p>

<p>The LIF antibody is a monoclonal antibody that targets the inhibitory factor known as leukemia inhibitory factor (LIF). This antibody has been extensively studied in the field of Life Sciences and has various applications. It can be used for detecting and quantifying LIF levels in biological samples, such as serum or tissue extracts, using techniques like ELISA or Western blotting. The LIF antibody can also be used for immunohistochemistry to visualize LIF expression in cells or tissues.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2F antibody, catalog no. 70R-9184</p>

<p>Ccl11 antibody was raised in rabbit using the C terminal of Ccl11 as the immunogen</p>

<p>Human Albumin antibody was raised against Human Albumin.</p>

<p>Rabbit polyclonal rPSB antibody (FITC)</p>

<p>The HSF1 antibody is a highly specific monoclonal antibody that targets human serum albumin (HSA). It is commonly used in immunoassays and molecular docking studies to detect and analyze the presence of HSA in various samples. This antibody forms a stable complex with HSA, allowing for accurate quantification and analysis.</p>

<p>DTL antibody was raised using a synthetic peptide corresponding to a region with amino acids VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV</p>

<p>The FGF21 antibody is a monoclonal antibody that specifically targets and inhibits the growth factor FGF21. This antibody has been shown to effectively block the activation of FGF21, preventing its binding to its receptors and subsequent downstream signaling. By blocking FGF21 activity, this antibody can potentially inhibit the growth and proliferation of cells that are dependent on FGF21 signaling.</p>

<p>PWWP2A antibody was raised using the C terminal of PWWP2A corresponding to a region with amino acids PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR</p>

<p>TMEM187 antibody was raised using the middle region of TMEM187 corresponding to a region with amino acids ECVSLASYGLALLHPQGFEVALGAHVVAAVGQALRTHRHYGSTTSATYLA</p>

<p>HAX1 antibody was raised in mouse using recombinant human HAX1 (1-279aa) purified from E. coli as the immunogen.</p>

<p>ZFP42 antibody was raised in rabbit using the middle region of ZFP42 as the immunogen</p>

<p>The Cry1 antibody is a monoclonal antibody that specifically targets the protein Cry1. This protein is produced by Bacillus thuringiensis, a bacterium commonly used as a biopesticide. The Cry1 antibody has been shown to have antiangiogenic properties, meaning it inhibits the growth of blood vessels. This can be beneficial in treating conditions such as cancer, where excessive blood vessel growth can promote tumor growth. Additionally, the Cry1 antibody has been found to bind to histidine residues on amyloid plaques, which are associated with neurodegenerative diseases like Alzheimer's. By binding to these plaques, the antibody may help prevent their formation or promote their clearance from the brain. Furthermore, the Cry1 antibody has demonstrated neutralizing activity against certain growth factors and chemokines involved in inflammation and immune responses. Its potential therapeutic applications extend beyond neurodegenerative diseases and include various areas of life sciences research.</p>

<p>Purified recombinant EDN2 protein (His tag)</p>

<p>The COMT antibody is a highly specialized antibody that targets catechol-O-methyltransferase (COMT), an enzyme involved in the metabolism of neurotransmitters like dopamine, epinephrine, and norepinephrine. This polyclonal antibody is designed to specifically recognize and bind to COMT, allowing for the detection and study of this important enzyme.</p>

<p>The Influenza B antibody is a monoclonal antibody that specifically targets the influenza B virus. It works by binding to a specific molecule called caspase-9, which is essential for the replication and spread of the virus. By neutralizing caspase-9, the antibody inhibits the growth and proliferation of the influenza B virus.</p>

<p>The AKT1 antibody is a monoclonal antibody that specifically targets β-catenin. It has been extensively tested and proven to be highly effective in detecting the presence of AKT1 in human serum samples. The antibody has also shown binding affinity to oncostatin, a protein involved in cell growth and differentiation. Additionally, it exhibits high specificity towards serum albumin protein, making it an ideal tool for various research applications. The AKT1 antibody can be used in immunohistochemistry, western blotting, and ELISA assays. Its activated electrode allows for easy and accurate detection of AKT1 levels. This monoclonal antibody is a valuable asset in the field of Life Sciences and can contribute significantly to research on anti-mesothelin therapy and taxol-induced apoptosis.</p>

<p>TJP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVVPETNKEPRYQEDPPAPQPKAAPRTFLRPSPEDEAIYGPNTKMVRFKK</p>

<p>The ALDOA antibody is a monoclonal antibody that belongs to the group of colony-stimulating antibodies. It specifically targets ALDOA, a protein involved in glucose metabolism. This antibody has been shown to inhibit the activity of ALDOA, thereby reducing glucose uptake and metabolism in cells. Additionally, it has been demonstrated to have inhibitory effects on other proteins such as MERTK and transferrin binding proteins. The ALDOA antibody can be used in various life science research applications, including studies on glucose metabolism, cell signaling pathways, and protein-protein interactions. With its high specificity and potency, this antibody is an invaluable tool for researchers in the field.</p>

<p>The Tyrosine Hydroxylase antibody is a highly specific antibody that binds to tyrosine hydroxylase, an enzyme involved in the synthesis of neurotransmitters such as dopamine and norepinephrine. This antibody is widely used in Life Sciences research to study the expression and localization of tyrosine hydroxylase in various tissues and cell types.</p>

<p>Mouse monoclonal HLCS antibody</p>

<p>The Caspase 3 antibody is a highly specialized phosphatase that targets actin filaments in cells. This antibody is commonly used in Life Sciences research for its ability to detect and analyze caspase 3, an enzyme involved in programmed cell death. The Caspase 3 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options based on their specific needs.</p>

<p>Rabbit polyclonal PPIA antibody (FITC)</p>

<p>Alpha 2 Antiplasmin protein is an acidic protein that exhibits natriuretic and growth factor-like properties. It has been shown to interact with the growth factor-1 receptor and promote cell proliferation in various cell types. Alpha 2 Antiplasmin protein can be found in human serum and can be detected using monoclonal antibodies. This protein is commonly used in Life Sciences research, particularly in studies involving electrode-based techniques and telomerase activity. Additionally, alpha 2 Antiplasmin protein has been implicated in regulating chemokine and insulin-like growth factor signaling pathways. It is a valuable tool for studying Native Proteins &amp; Antigens and is widely used in the field of Proteins and Antigens research.</p>

<p>DPP3 antibody is a monoclonal antibody that targets the Dipeptidyl Peptidase 3 (DPP3) molecule. It has been widely used in Life Sciences research for various applications. This antibody specifically binds to DPP3, which is an enzyme involved in the cleavage of chemokines and other peptides. By targeting DPP3, this antibody can modulate the activity of chemokines and potentially impact immune responses. Additionally, DPP3 antibody has been shown to have low cross-reactivity with other proteins present in human serum, making it a reliable tool for research purposes. This highly specific antibody can be used in various assays such as immunohistochemistry, Western blotting, and flow cytometry to study the expression and function of DPP3 in different biological systems. With its high affinity and specificity, DPP3 antibody provides researchers with a valuable tool to investigate the role of DPP3 in various cellular processes and diseases.</p>

<p>The LTA4H antibody is a monoclonal antibody that targets the enzyme leukotriene A4 hydrolase (LTA4H). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to inhibit the activity of LTA4H, which plays a crucial role in the production of leukotrienes, potent mediators of inflammation.</p>

<p>Mouse monoclonal JEV PreM antibody</p>

<p>ZIM3 antibody was raised in rabbit using the middle region of ZIM3 as the immunogen</p>

<p>AFP antibody was raised in mouse using purified human alpha-fetoprotein as the immunogen.</p>

<p>LOC652825 antibody was raised using the middle region of Loc652825 corresponding to a region with amino acids QSRSFRILWLLEEIKQPYELKRYYRDSSTHLAPDSLKTIHPLGKSPVLEW</p>

<p>The NF kappaB p65 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to the NF kappaB p65 protein, which plays a crucial role in various cellular processes such as hepatocyte growth, endothelial growth, and collagen synthesis.</p>

<p>Rabbit polyclonal EGFR antibody (Thr678)</p>

<p>Rabbit polyclonal RPAP1 antibody</p>

<p>NKD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LASGGPVLGREHLRELPALVVYESQAGQPVQRHEHHHHHEHHHHYHHFYQ</p>

<p>Purified recombinant TRIM28 protein (His tag)</p>

<p>APP antibody was raised in goat using a peptide; GYENPTYKFFEQMQN, as the immunogen.</p>

<p>The Codeine antibody is a highly effective antiviral agent that has been specifically designed to target and neutralize the growth factor of codeine in human serum. This antibody is available in both polyclonal and monoclonal forms, ensuring maximum efficacy and specificity. It is widely used in the field of Life Sciences for research purposes, as well as in clinical settings for diagnostic and therapeutic applications.</p>

<p>Purified recombinant STMN4 protein (His tag)</p>

<p>Arginase 2 antibody was raised using the C terminal of ARG2 corresponding to a region with amino acids SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT</p>

<p>Fgf1 antibody was raised in rabbit using the N terminal of Fgf1 as the immunogen</p>

<p>The p16 antibody is a diagnostic reagent in the field of Life Sciences. It is an antibody that specifically targets and binds to p16, a protein involved in cell cycle regulation. The p16 antibody is commonly used in research and clinical settings for the detection and analysis of p16 expression levels.</p>

<p>Purified recombinant PPP4C protein (His tag)</p>

<p>CYP4A1/CYP4A2/CYP4A3 antibody was raised in rabbit using a synthetic peptide as the immunogen.</p>

<p>SMARCA2 antibody was raised in rabbit using the middle region of SMARCA2 as the immunogen</p>

<p>Rat monoclonal CD43 antibody (FITC)</p>

<p>Rabbit polyclonal SHANK1 antibody</p>

<p>Purified Rabbit polyclonal OR56B4 antibody</p>

<p>Mouse anti Human IgG1 antibody</p>

<p>Mouse monoclonal ITFG2 antibody</p>

<p>Mouse monoclonal ANKRD53 antibody</p>

<p>ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of P4HB antibody, catalog no. 70R-5389</p>

<p>The Bax antibody is a highly effective monoclonal antibody that is widely used in Life Sciences research. It is specifically designed to target and inhibit the pro-angiogenic activity of Bax, a protein that plays a crucial role in angiogenesis. This antibody has been extensively tested and validated using polymerase chain techniques, demonstrating its high specificity and potency.</p>

<p>The DCX antibody is a highly specialized monoclonal antibody that targets CD33, a protein expressed on the surface of certain cells. This antibody has been extensively studied and has shown promising results in various applications.</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside: Enhance your tuberculosis treatment with 6-Fluoro-3-indoxyl-beta-D-galactopyranoside. This powerful antituberculosis drug belongs to the class of rifamycins and is specifically designed to combat tuberculosis infections. Its bactericidal activity inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Tested on human erythrocytes using a patch-clamp technique, this active compound has shown high efficacy. Metabolized through various metabolic transformations, including hydrolysis by esterases or glucuronidases and oxidation by cytochrome P450 enzymes, it ensures optimal results in treating mycobacterium infections. With its ability to bind to markers expressed at high levels in Mycobacterium tuberculosis strains, it effectively inhibits cell growth in culture. Tilmicosin: For effective veterinary treatment of respiratory disorders</p>

<p>The GANP antibody is a highly specific monoclonal antibody that is used in various assays to detect and quantify the presence of GANP (glycosylation-associated nuclear protein) in samples. It specifically recognizes the tyrosine phosphorylated form of GANP, which is activated under certain conditions. This antibody has been extensively validated and has shown high sensitivity and specificity in detecting GANP in nuclear extracts from various cell types.</p>

<p>Purified Rabbit polyclonal JAK2 antibody (Tyr570)</p>

<p>The Hydrocodone antibody is a monoclonal antibody that specifically targets and binds to glial fibrillary acidic protein (GFAP), an important marker for astrocytes. It has been shown to inhibit the hydroxylase activity of GFAP, which plays a key role in cholinergic neurotransmission. This antibody is widely used in Life Sciences research to study the function and regulation of astrocytes in various physiological and pathological conditions.</p>

<p>The FAK antibody is a powerful tool in the field of Life Sciences. It is an antiviral antibody that specifically targets and neutralizes a cell antigen known as focal adhesion kinase (FAK). FAK is a key regulator of cell growth, migration, and survival, making it an important target for research and therapeutic applications.</p>

<p>beta Tubulin antibody was raised in mouse using recombinant human beta-Tubulin (1-445aa) purified from E. coli as the immunogen.</p>

<p>The RAD17 antibody is a highly specialized growth factor that plays a crucial role in various cellular processes. It has been shown to interact with epidermal growth factor (EGF) and TGF-beta, neutralizing their effects on cell proliferation and differentiation. This monoclonal antibody specifically targets the activated form of RAD17, inhibiting its interaction with β-catenin and other proteins involved in cell signaling pathways. The RAD17 antibody is widely used in Life Sciences research to study the function of this important cell antigen. Additionally, it has been shown to have potential therapeutic applications in diseases related to abnormal cell growth, such as cancer and adipose tissue disorders. With its high specificity and potency, the RAD17 antibody is an invaluable tool for researchers looking to gain deeper insights into cellular processes and develop innovative treatments.</p>

<p>Purified Rabbit polyclonal PPP1CB antibody</p>

<p>Purified recombinant ABRACL protein (His tag)</p>

<p>KCNJ9 antibody was raised using the middle region of KCNJ9 corresponding to a region with amino acids CQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSAR</p>

<p>Phenobarbital antibody was raised in mouse using phenobarbital conjugated to KLH as the immunogen.</p>

<p>Rabbit polyclonal OR5V1 antibody</p>

<p>Rabbit polyclonal Synuclein gamma antibody</p>

<p>MEGVHRKPSF LALPGHLVKS EETVILQCWS DVMFEHFLLH REGKFNNTLH LIGEHHDGVS KANFSIGPMM PVLAGTYRCY GSVPHSPYQL SAPSDPLDMV IIGLYEKPSL SAQPGPTVQA GENVTLSCSS RSSYDMYHLS REGEAHERRL PAVRSINGTF QADFPLGPAT HGGTYRCFGS FRDAPYEWSN SSDPLLVSVT GN</p>

<p>Rabbit polyclonal UNC5A antibody</p>

<p>WDR6 antibody was raised using the C terminal of WDR6 corresponding to a region with amino acids TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE</p>

<p>ENPP6 antibody was raised using the middle region of ENPP6 corresponding to a region with amino acids ELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWS</p>

<p>Similar to heparin, located in the extracellular matrix, the glycosaminoglycan of heparan plays important physiological roles in anticoagulation and angiogenesis. The acidic polysaccharide of heparan consists of a heterogeneous disaccharide repeating unit of hexosamine and uronic acid (L-iduronic or D-glucuronic acid) connected through 1-4 linkages and modified with various functional groups. Sulfated regions of heparan sulfate are interspaced with less or non-sulfated regions but heparin sulfate contains no non-sulfated regions.</p>

<p>CKMM antibody was raised using the middle region of CKM corresponding to a region with amino acids GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI</p>

<p>Mouse monoclonal RFXANK antibody</p>

<p>TMEM123 antibody was raised using the C terminal of TMEM123 corresponding to a region with amino acids SSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRG</p>

<p>Mouse monoclonal CD33 antibody (FITC)</p>

<p>Rabbit polyclonal SF4 antibody</p>

<p>FGD1 antibody was raised in rabbit using the C terminal of FGD1 as the immunogen</p>

<p>Mouse monoclonal MOBKL2B antibody</p>

<p>ZNF660 antibody was raised in rabbit using the N terminal of ZNF660 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1191 antibody, catalog no. 70R-4448</p>

<p>MRPL39 antibody was raised using the N terminal of MRPL39 corresponding to a region with amino acids TELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNIST</p>

<p>The OR1A1 antibody is a polyclonal antibody that specifically targets antiphospholipid antibodies. It has been shown to have high affinity and specificity for these autoantibodies, making it an effective tool for research and diagnostic purposes. The OR1A1 antibody can be used in various applications such as immunohistochemistry, western blotting, and ELISA assays. It has also been used to study the role of antiphospholipid antibodies in diseases such as collagen vascular diseases, thrombosis, and pregnancy complications. This antibody is produced using advanced techniques in the field of life sciences and undergoes rigorous quality control measures to ensure its performance and reliability. With its ability to detect a wide range of target antigens including alpha-fetoprotein, erythropoietin, tnf-related apoptosis-inducing ligand (TRAIL), basic protein, osteopontin, and steroids, the OR1A1 antibody is a valuable tool for researchers in</p>

<p>The SCG3 antibody is a powerful substance that inhibits the activity of specific nucleotides. This polyclonal antibody is widely used in analytical and life sciences research to study the function and interactions of various proteins and ligands. By binding to specific targets, the SCG3 antibody can effectively inhibit their activity, providing valuable insights into cellular processes and signaling pathways. With its high specificity and potency, this antibody is an essential tool for researchers seeking to understand the intricate mechanisms of protein function.</p>

<p>Region of IL16 protein corresponding to amino acids MPDLNSSTDS AASASAASDV SVESTAEATV CTVTLEKMSA GLGFSLEGGK GSLHGDKPLT INRIFKGAAS EQSETVQPGD EILQLGGTAM QGLTRFEAWN IIKALPDGPV TIVIRRKSLQ SKETTAAGDS.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF2S2 antibody, catalog no. 70R-4905</p>

<p>SEMA6D antibody was raised using the N terminal of SEMA6D corresponding to a region with amino acids VSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLY</p>

<p>PTPRR antibody was raised using the N terminal of PTPRR corresponding to a region with amino acids TATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIPTPREKV</p>

<p>ATP10D antibody was raised using the C terminal of ATP10D corresponding to a region with amino acids LFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITLLDA</p>

<p>Purified Polyclonal ERAS antibody</p>

<p>Sheep polyclonal Zaleplon antibody</p>

<p>ST6GALNAC6 antibody was raised using the C terminal of ST6GALNAC6 corresponding to a region with amino acids YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP</p>

<p>Rabbit polyclonal Synapsin1 antibody</p>

<p>Profilin 1 antibody was raised using the N terminal of PFN1 corresponding to a region with amino acids AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL</p>

<p>The CRYAB antibody is a monoclonal antibody that specifically targets the colony-stimulating factor known as GM-CSF. This antibody has been extensively studied in the field of Life Sciences and has shown great potential as a therapeutic agent. It acts by neutralizing the activity of GM-CSF, which is responsible for promoting the growth and activation of various immune cells.</p>

<p>Rat monoclonal CIRE antibody (FITC)</p>

<p>UCP4 antibody was raised in rabbit using a 16 amino acid peptide from human UCP4 as the immunogen.</p>

<p>The OTX2 antibody is a highly specialized monoclonal antibody that targets a specific molecule involved in growth factor signaling. It is widely used in Life Sciences research for its neutralizing properties and ability to block the activity of this target molecule. This antibody has been extensively studied and proven to be effective in inhibiting the function of the target molecule, leading to important discoveries in various fields of research.</p>

<p>Horse RBC antibody was raised in rabbit using equine erythrocytes as the immunogen.</p>

<p>The CD49f antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that exhibits both antiangiogenic and cytotoxic properties. This antibody specifically targets and binds to CD49f, which is an activated growth factor receptor found on the surface of cells. By binding to CD49f, the antibody inhibits the signaling pathway that promotes angiogenesis and cell growth.</p>

<p>Mouse monoclonal Pyruvate Dehydrogenase antibody (C-terminus)</p>

<p>Rabbit polyclonal SERPINB9 antibody</p>

<p>SLC33A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG</p>

<p>Thyroglobulin antibody is a specific antibody that is used in the field of Life Sciences. It is an activated monoclonal antibody that targets nuclear antigens. Thyroglobulin antibody has been extensively studied for its role in autoimmune diseases and has shown to be effective in neutralizing autoantibodies. Additionally, this antibody has been found to interact with chemokines, fibronectin, collagen, and TNF-α. Its high specificity and neutralizing properties make it a valuable tool for research purposes in the field of immunology and molecular biology.</p>

<p>DPY19L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids APVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKR</p>

<p>IRF5 antibody was raised in mouse using recombinant human IRF-5 (176-240aa) purified from E. coli as the immunogen.</p>

<p>The TRIB2 antibody is a monoclonal antibody that specifically targets the EBNA1 protein. This antibody is widely used in Life Sciences research to study various cellular processes. It has been shown to inhibit glycation, which is the non-enzymatic reaction between proteins and sugars that can lead to the formation of advanced glycation end products (AGEs). The TRIB2 antibody also plays a crucial role in cholinergic signaling by binding to plasmids and promoting the expression of choline acetyltransferase, an enzyme responsible for synthesizing the neurotransmitter acetylcholine. Additionally, this antibody has been found to modulate glycosylation patterns by interacting with glycopeptides and regulating the activity of phosphatases involved in signal transduction pathways. Its ability to modulate interferon production makes it a valuable tool in immunology research. Overall, the TRIB2 antibody offers researchers a powerful tool for studying autoantibodies and their role in various diseases and biological processes</p>

<p>TMTC2 antibody was raised using the N terminal of TMTC2 corresponding to a region with amino acids SNSDNPAADSDSLLTRTLTFFYLPTKNLWLLLCPDTLSFDWSMDAVPLLK</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CEP55 antibody, catalog no. 70R-2147</p>

<p>CYP4F12 antibody was raised using the middle region of CYP4F12 corresponding to a region with amino acids DGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDV</p>

<p>The ICAM2 antibody is a powerful tool in the field of Life Sciences. It specifically targets and inhibits the rho-associated protein kinase, which plays a crucial role in various cellular processes. This antibody can be used for a wide range of applications, including nucleic acid conjugates, protein kinase inhibitors, and as a cdk2 inhibitor. Additionally, it has been extensively used in research as a diagnostic agent for genotoxicity studies.</p>

<p>Purified Rabbit polyclonal ENDOGL1 antibody</p>

<p>CGS 15435 is a synthetic compound that functions as a dopamine receptor agonist, derived from chemical synthesis processes involving targeted modifications of organic compounds. It exhibits high affinity and selectivity toward specific subtypes of dopamine receptors, which are G-protein-coupled receptors critical to neurotransmission in the central nervous system.</p>

<p>Rabbit polyclonal PTPIP51 antibody</p>

<p>The ASK1 antibody is a highly specialized monoclonal antibody that targets the activated form of the apoptosis signal-regulating kinase 1 (ASK1) enzyme. This antibody is commonly used in research laboratories and the pharmaceutical industry for various applications in the field of life sciences.</p>

<p>Purified Rabbit polyclonal ETK antibody (Tyr40)</p>

<p>Rabbit polyclonal GPR146 antibody</p>

<p>TSKS antibody was raised using the N terminal of TSKS corresponding to a region with amino acids MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKK</p>

<p>Rabbit polyclonal PO5F1 antibody</p>

<p>Purified Polyclonal CARD14 antibody</p>

<p>TM9SF4 antibody was raised using the N terminal of TM9SF4 corresponding to a region with amino acids HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR</p>

<p>Mouse monoclonal CCM2 antibody</p>

<p>Purified recombinant CA11 protein (His tag)</p>

<p>KLRC3 antibody was raised using the N terminal of KLRC3 corresponding to a region with amino acids MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASL</p>

<p>Rabbit polyclonal USP9X antibody</p>

<p>The Cyclin B1 antibody is a highly specialized polyclonal antibody that is used in the field of Life Sciences. It is specifically designed to target and bind to the Cyclin B1 protein, which plays a crucial role in cell division and proliferation. This antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific needs.</p>

<p>Purified Polyclonal KLF17 antibody</p>

<p>UBE2E2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLD</p>

<p>NGAL protein is a multifunctional protein that plays a crucial role in various biological processes. It acts as an epidermal growth factor and has anti-mesothelin properties, making it valuable in the field of Life Sciences. NGAL protein functions as a growth factor and chemokine, promoting cell proliferation and migration. It can be used as a recombinant protein or antigen for research purposes.</p>

<p>The RAP1B antibody is an acidic growth factor that plays a crucial role in various biological processes. It is commonly used in Life Sciences research to study the functions of RAP1B, a small GTPase protein. This polyclonal antibody is highly specific and binds to RAP1B with high affinity, making it an excellent tool for detecting and quantifying RAP1B levels in different samples.</p>

<p>The Cyclin D1 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to Cyclin D1, an important protein involved in cell cycle regulation. It is available as both monoclonal and polyclonal antibodies, offering researchers a variety of options for their experiments.</p>

<p>Recombinant Human NUBP2 protein</p>

<p>The TCP1 antibody is a powerful tool used in various research fields, particularly in the life sciences. This antibody is known for its inhibitory properties against natriuretic peptides and activated protein kinases. It also acts as a neutralizing agent against chemokines, making it an essential component in immunoassays.</p>

<p>Human IgE antibody was raised in mouse using human myeloma IgE as the immunogen.</p>

<p>CLN8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFGVQSTAAGLWALLGDPVLHADKARGQQNWCWFHITTATGFFCFENVAV</p>

<p>The CD130 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It specifically targets the tyrosine kinase receptor CD130, which plays a crucial role in various cellular processes. This antibody can be used for research purposes to study the function and regulation of CD130.</p>

<p>N-[4-(Aminosulfonyl)phenyl]-2-[3-cyano-4-(2-methylpropoxy)phenyl]-4-methyl-5-thiazolecarboxamide is a potent, high purity, and selective activator of the transient receptor potential cation channel subfamily V member 1 (TRPV1) ion channel. It has been shown to inhibit the activity of TRPV1 channels in rat dorsal root ganglion neurons, thereby blocking pain signals. N-[4-(Aminosulfonyl)phenyl]-2-[3-cyano-4-(2-methylpropoxy)phenyl]-4-methyl-5-thiazolecarboxamide has also been shown to be an effective inhibitor of TRPA1 channels and a blocker of histamine H(3) receptors. This product is not expected to cause any immunological reactions in humans or animals.</p>

<p>The Human Growth Hormone antibody is a reactive monoclonal antibody that specifically targets and neutralizes the human serum albumin protein. This antibody has been extensively studied in the field of Life Sciences and has shown potential therapeutic applications. It can be used to inhibit the activity of growth hormone or other agonist proteins, making it an important tool for research and development.</p>

<p>RDH16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLV</p>

<p>Rabbit polyclonal SMARCC1 antibody</p>

<p>Mouse monoclonal EXOSC7 antibody</p>

<p>Mouse monoclonal ELK3 antibody</p>

<p>Purified recombinant PET117 protein (His tag)</p>

<p>AMA1 protein is a key component in the field of Life Sciences. It is involved in various processes, including adipose activation and creatine kinase activity. This protein can be found in human serum and plays a crucial role in the apical membrane function. The AMA1 protein can be immobilized using an electrode and has been studied in relation to sorafenib treatment. Recombinant forms of this protein, along with specific monoclonal antibodies, are widely used in research and diagnostic applications. Additionally, AMA1 protein has been found to interact with collagen, further highlighting its importance in cellular processes.</p>

<p>Mouse Monoclonal ACAT2 antibody</p>

<p>Normal Pig Serum is a high-quality serum that is widely used in the Life Sciences and Veterinary Applications. It is derived from healthy pigs and contains a variety of important components, including glycosylation inhibitors, chemokine binding proteins, and oligodeoxynucleotides. This serum is particularly valuable for researchers working with monoclonal antibodies, as it provides an optimal environment for antibody production and stability.</p>

<p>ATXN2 antibody was raised in rabbit using the middle region of ATXN2 as the immunogen</p>

<p>The NMT2 antibody is a highly specialized biological agent that has a range of important applications in the field of Life Sciences. This antibody is known for its high bioavailability and exceptional binding affinity to erythropoietin receptors. It has been extensively studied for its ability to modulate various biological effects, including angiogenic response and the production of polyunsaturated fatty acids such as arachidonic acid.</p>

<p>MTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFA</p>

<p>The CD70 antibody is a monoclonal antibody that targets the CD70 protein. It has been shown to inhibit the activity of phosphatase and nuclear factor kappa-light-chain-enhancer in B cells, leading to decreased polymerase activity and growth factor activation. This antibody also has cytotoxic effects on mycoplasma genitalium, as it activates endonuclease and caspase-9, resulting in cell death. The CD70 antibody is widely used in Life Sciences research and has potential applications in the development of targeted therapies for various diseases.</p>

<p>LRRTM4 antibody was raised using the middle region of LRRTM4 corresponding to a region with amino acids FYWLKNFKGNKESTMICAGPKHIQGEKVSDAVETYNICSEVQVVNTERSH</p>

<p>Mouse monoclonal MGRN1 antibody</p>

<p>OSGIN1 antibody was raised using the N terminal of OSGIN1 corresponding to a region with amino acids APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW</p>

<p>The NEK6 antibody is a highly specialized monoclonal antibody that is used in various applications within the Life Sciences field. It is designed to target and bind to NEK6, an enzyme involved in cell cycle regulation and signaling pathways. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>RAB5B antibody was raised using the N terminal of RAB5B corresponding to a region with amino acids MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE</p>

<p>Rabbit polyclonal MYPT1 antibody (Thr696)</p>

<p>C12orf11 antibody was raised in Rabbit using Human C12orf11 as the immunogen</p>

<p>RDH11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR</p>

<p>Rat monoclonal IL4 antibody (allophycocyanin)</p>

<p>Mouse monoclonal TULP3 antibody</p>

<p>Esrrg antibody was raised in rabbit using the middle region of Esrrg as the immunogen</p>

<p>Rat lymphocyte antibody was raised in rabbit using RBC-free rat thymus and spleen cells as the immunogen.</p>

<p>Rabbit polyclonal SSB antibody (Ser366)</p>

<p>The EPHA5 antibody is a highly specialized antibody that targets the epidermal growth factor. It plays a crucial role in various Life Sciences applications, particularly in the study of adipose tissues. This antibody has been shown to affect important cellular processes such as glycosylation and cell adhesion through its interaction with proteins like E-cadherin and β-catenin.</p>