Biochemicals and Reagents

<p>Region of IL3 protein corresponding to amino acids MISDRGSDAH HLLRTLDCRT IALEILVKLP YPQVSGLNNS DDKANLRNST LRRVNLDEFL KSQEEFDSQD TTDIKSKLQK LKCCIPAAAS DSVLPGVYNK DLDDFKKKLR FYVIHLKDLQ PVSVSRPPQP TSSSDNFRPM TVEC.</p>

<p>Phencyclidine antibody was raised in mouse using phencyclidine (PCP)-BSA as the immunogen.</p>

<p>TUG antibody was raised in Mouse using a purified recombinant fragment of TUG expressed in E. coli as the immunogen.</p>

<p>The Tau antibody is a powerful tool in the field of Life Sciences. It belongs to the group of antibodies that are capable of neutralizing multidrug resistance and TGF-beta. This antibody can be used as both a polyclonal and monoclonal antibody, depending on the specific needs of the experiment or study. It has been extensively tested and validated, ensuring its reliability and accuracy.</p>

<p>21-481 amino acids: MHDGHDDDVI DIEDDLDDVI EEVEDSKPDT TAPPSSPKVT YKAPVPTGEV YFADSFDRGT LSGWILSKAK KDDTDDEIAK YDGKWEVEEM KESKLPGDKG LVLMSRAKHH AISAKLNKPF LFDTKPLIVQ YEVNFQNGIE CGGAYVKLLS KTPELNLDQF HDKTPYTIMF GPDKCGEDYK LHFIFRHKNP KTGIYEEKHA KRPDADLKTY FTDKKTHLYT LILNPDNSFE ILVDQSVVNS GNLLNDMTPP VNPSREIEDP EDRKPEDWDE RPKIPDPEAV KPDDWDEDAP AKIPDEEATK PEGWLDDEPE YVPDPDAEKP EDWDEDMDGE WEAPQIANPR CESAPGCGVW QRPVIDNPNY KGKWKPPMID NPSYQGIWKP RKIPNPDFFE DLEPFRMTPF SAIGLELWSM TSDIFFDNFI ICADRRIVDD WANDGWGLKK AADGAAEPGV VGQMIEAAEE RP</p>

<p>Rabbit polyclonal PHLA2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SF1 antibody, catalog no. 70R-4778</p>

<p>VTI1A antibody was raised using a synthetic peptide corresponding to a region with amino acids SSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKEL</p>

<p>Purified recombinant Human RAN protein</p>

<p>Recombinant Human NMT1 protein (His tag)</p>

<p>Mouse monoclonal CRTC3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTCH1 antibody, catalog no. 70R-6354</p>

<p>Human serum off the clot, mixed gender, pooled, Sterile filtered.  Screened negative for standard STD Panel.</p>

<p>PABPN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WNT5A antibody, catalog no. 70R-6956</p>

<p>Purified recombinant Human ACO1 protein</p>

<p>UBE2J2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK</p>

<p>The GRIA2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind specifically to the GRIA2 protein, which plays a crucial role in various cellular processes including fas-mediated apoptosis, collagen synthesis, and growth factor signaling.</p>

<p>TTC14 antibody was raised using the N terminal of TTC14 corresponding to a region with amino acids LLSLLRSEQQDNPHFRSLLGSAAEPARGPPPQHPLQGRKEKRVDNIEIQK</p>

<p>Purified recombinant F2 protein (His tag)</p>

<p>Affinity purified Rabbit polyclonal SH3BP1 antibody</p>

<p>TRAM1L1 antibody was raised using the middle region of TRAM1L1 corresponding to a region with amino acids LWAIVFILGRLVTLIVSVLTVGFHLAGSQNRNPDALTGNVNVLAAKIAVL</p>

<p>Tgfb3 antibody was raised in rabbit using the middle region of Tgfb3 as the immunogen</p>

<p>Purified native Rabbit Troponin I protein (Skeletal Muscle)</p>

<p>GJD3 antibody was raised in rabbit using the C terminal of GJD3 as the immunogen</p>

<p>FUT11 antibody was raised in Rabbit using Human FUT11 as the immunogen</p>

<p>Rabbit polyclonal ARHGEF9 antibody</p>

<p>Rabbit polyclonal TMEM176A antibody</p>

<p>Claudin 23 antibody was raised using the C terminal of CLDN23 corresponding to a region with amino acids IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE</p>

<p>Rabbit polyclonal MED26 antibody</p>

<p>Rabbit Polyclonal CCNB1IP1 antibody</p>

<p>MAD2L1 antibody was raised in Rabbit using Human MAD2L1 as the immunogen</p>

<p>Sulphaphenazole Conjugate for use in immunoassays</p>

<p>NLRP2 antibody was raised in Rabbit using Human NLRP2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RABEPK antibody, catalog no. 70R-4502</p>

<p>Rabbit polyclonal Lck antibody (Tyr505)</p>

<p>The PER2 antibody is a highly specialized monoclonal antibody that is widely used in the field of Life Sciences. It is specifically designed to target and bind to the PER2 protein, which plays a crucial role in regulating circadian rhythms. This antibody has been extensively validated using mass spectrometric methods and has shown exceptional specificity and sensitivity.</p>

<p>Rabbit polyclonal KCC2 antibody (Ser940)</p>

<p>Fibronectin 1 antibody was raised using the C terminal of FN1 corresponding to a region with amino acids NCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR</p>

<p>Rabbit polyclonal JAK2 antibody (Tyr221)</p>

<p>AARS antibody was raised using the C terminal of AARS corresponding to a region with amino acids VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT</p>

<p>Mouse monoclonal GPHN antibody</p>

<p>Rabbit polyclonal Collagen IV alpha 5 antibody</p>

<p>Mouse monoclonal NAPEPLD antibody</p>

<p>Purified recombinant CHRNA6 protein (His tag)</p>

<p>Rabbit polyclonal TGFBR1 antibody (Ser165)</p>

<p>ERGIC3 antibody was raised in Rabbit using Human ERGIC3 as the immunogen</p>

<p>The FHL2 antibody is a polyclonal antibody that specifically targets hepatocyte growth factor (HGF), a potent growth factor involved in various biological processes. This antibody can be used for immobilization or activation of HGF in different experimental setups. It is also available as a monoclonal antibody, which offers high specificity and reproducibility. The FHL2 antibody has been shown to have cytotoxic effects on certain cancer cell lines, making it a valuable tool in cancer research. Additionally, this antibody can neutralize the activity of angptl3, a glycoprotein involved in lipid metabolism. Its ability to function at low pH levels further enhances its versatility in various life science applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHIC2 antibody, catalog no. 70R-6864</p>

<p>Mouse monoclonal SHPRH antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SI antibody, catalog no. 70R-7205</p>

<p>Purified recombinant Human SH3BGRL protein (His tag)</p>

<p>Mad1 Antibody</p>

<p>CHRNA7 antibody was raised using the middle region of CHRNA7 corresponding to a region with amino acids VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF</p>

<p>C20ORF111 antibody was raised using the N terminal Of C20Orf111 corresponding to a region with amino acids RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG</p>

<p>NXF5 antibody was raised using the middle region of NXF5 corresponding to a region with amino acids ITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWE</p>

<p>NBAS antibody was raised in Rabbit using Human NBAS as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACSF2 antibody, catalog no. 70R-10181</p>

<p>The GOLM1 antibody is an industrial-grade product used in the field of Life Sciences. It is designed to detect and bind to autoantibodies, which are antibodies produced by the immune system that mistakenly attack the body's own tissues. The GOLM1 antibody utilizes peptide mimics to accurately identify and target specific polypeptide expressions. This allows researchers and scientists to study the role of GOLM1 as an antigen in various biological processes.</p>

<p>TDGF1 antibody is a monoclonal antibody that specifically targets and binds to TDGF1, also known as Natriuretic factor-α. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications. TDGF1 antibody has been used in studies involving TNF-α, botulinum toxin, Helicobacter pylori, peptide nucleic acids, binding proteins, microspheres, and β-catenin.</p>

<p>E2F8 antibody was raised in rabbit using the middle region of E2F8 as the immunogen</p>

<p>WDR63 antibody was raised using the middle region of WDR63 corresponding to a region with amino acids EIALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEK</p>

<p>SETD3 antibody was raised in rabbit using the middle region of SETD3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPS15A antibody, catalog no. 70R-3009</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNNT3 antibody, catalog no. 70R-3256</p>

<p>RRM1 antibody was raised using the N terminal of RRM1 corresponding to a region with amino acids ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL</p>

<p>Purified recombinant Human PTP4A2 protein</p>

<p>Rat monoclonal CD8 antibody (allophycocyanin); IgG2a kappa</p>

<p>COX7C antibody was raised in Rabbit using Human COX7C as the immunogen</p>

<p>Purified Polyclonal SENP8 antibody</p>

<p>Rabbit polyclonal ZNF287 antibody</p>

<p>ZSWIM3 antibody was raised using the N terminal of ZSWIM3 corresponding to a region with amino acids SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRY</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STAG3 antibody, catalog no. 70R-5513</p>

<p>EPOr antibody was raised using the N terminal of EPOR corresponding to a region with amino acids DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL</p>

<p>DDX27 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLGLIGTIGEDDEVPVEPESDSGDEEEEGPIVLGRRQKALGKNRSADFNP</p>

<p>VZV protein is a native protein and antigen that plays a crucial role in various biological processes. It has been shown to interact with caspase-9, which is involved in apoptosis regulation. Additionally, VZV protein has been found to have an impact on adipose tissue, particularly adipocytes. It interacts with gapdh and phosphatase enzymes, influencing metabolic pathways within these cells. VZV protein also exhibits neutralizing properties and can stimulate the production of colony-stimulating factors, including GM-CSF. This versatile protein has been extensively studied and is the target of monoclonal antibodies and autoantibodies. Its multifunctional nature makes it a valuable tool for research in various fields such as immunology and cell biology.</p>

<p>Mouse monoclonal OBFC2B antibody</p>

<p>The HSP70 antibody is a highly effective neutralizing agent that targets activated aldo-keto reductase and E-cadherin. It is widely used in the field of Life Sciences for its ability to inhibit chemokine activity and promote cellular homeostasis. This monoclonal antibody is formulated with high-quality excipients to ensure stability and efficacy. Additionally, it has shown promising results in studies involving Bacillus thuringiensis, amyloid plaque formation, and the regulation of GM-CSF (colony-stimulating factor) and interferon production. The HSP70 antibody is a valuable tool for researchers and clinicians alike, offering targeted therapy options and potential breakthroughs in various diseases and conditions.</p>

<p>The SLC6A14 antibody is a highly specific polyclonal antibody that targets the SLC6A14 protein. This protein is involved in the transport of amino acids across cell membranes and plays a crucial role in various biological processes. The SLC6A14 antibody has been extensively tested and validated for its specificity, sensitivity, and neutralizing activity.</p>

<p>Region of Apo-SAA1 protein corresponding to amino acids MRSFFSFLGE AFDGARDMWR AYSDMREANY IGSDKYFHAR GNYDAAKRGP GGVWAAEAIS DARENIQRFF GHGAEDSLAD QAANEWGRSG KDPNHFRPAG LPEKY.</p>

<p>Rabbit polyclonal PDRG1 antibody</p>

<p>Mouse monoclonal SLFNL1 antibody</p>

<p>The POR antibody is a highly specific monoclonal antibody that targets protease activity. It is widely used in the field of Life Sciences for various applications, including research and diagnostics. This antibody has been extensively studied and validated for its ability to detect and quantify proteins involved in key biological processes.</p>

<p>EYA3 antibody was raised in Rabbit using Human EYA3 as the immunogen</p>

<p>Mouse monoclonal COX6A1 antibody</p>

<p>Heat inactivated E. coli O157:H7 cells</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACSL1 antibody, catalog no. 70R-6937</p>

<p>RASSF6 antibody was raised in rabbit using the middle region of RASSF6 as the immunogen</p>

<p>The NET antibody is a colloidal solution that contains antibodies specifically designed to target and bind to neutrophil extracellular traps (NETs). NETs are web-like structures composed of DNA, histones, and antimicrobial proteins that are released by activated neutrophils as part of the immune response to infections.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PCSK6 antibody, catalog no. 70R-9557</p>

<p>SYNCRIP antibody was raised using the middle region of SYNCRIP corresponding to a region with amino acids IEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGG</p>

<p>Rabbit polyclonal OR52E6 antibody</p>

<p>RTP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEA</p>

<p>Goat Red Blood Cells are chemokine-rich biospecimens commonly used in veterinary applications. They contain growth factors, such as fibronectin and collagen, which play a crucial role in wound healing and tissue regeneration. These red blood cells also serve as a valuable source of excipients for drug formulation and delivery systems.</p>

<p>Rabbit polyclonal HDAC1 antibody (Ser421)</p>

<p>1-394 amino acids: MSGEDEQQEQ TIAEDLVVTK YKMGGDIANR VLRSLVEASS SGVSVLSLCE KGDAMIMEET GKIFKKEKEM KKGIAFPTSI SVNNCVCHFS PLKSDQDYIL KEGDLVKIDL GVHVDGFIAN VAHTFVVDVA QGTQVTGRKA DVIKAAHLCA EAALRLVKPG NQNTQVTEAW NKVAHSFNCT PIEGMLSHQL KQHVIDGEKT IIQNPTDQQK KDHEKAEFEV HEVYAVDVLV SSGEGKAKDA GQRTTIYKRD PSKQYGLKMK TSRAFFSEVE RRFDAMPFTL RAFEDEKKAR MGVVECAKHE LLQPFNVLYE KEGEFVAQFK FTVLLMPNGP MRITSGPFEP DLYKSEMEVQ DAELKALLQS SASRKTQKKK KKKASKTAEN ATSGETLEEN EAGDLEHHHH HH</p>

<p>Purified Polyclonal PAHT antibody</p>

<p>PHF6 antibody was raised in rabbit using the C terminal of PHF6 as the immunogen</p>

<p>The XPA antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets and binds to XPA, a protein involved in DNA repair. This antibody has been widely used in studies investigating the role of XPA in various cellular processes, including DNA damage response and repair mechanisms. The XPA antibody has shown high specificity and sensitivity in detecting XPA protein levels in human serum samples. It has also been used to study the interaction between XPA and other proteins, such as taxol, atrial natriuretic peptide, and growth factors. Additionally, this antibody has been used in the development of nanocomposites for drug delivery systems and as a tool for neutralizing specific proteins in monoclonal antibody-based therapies.</p>

<p>Mouse monoclonal Ig kappa light chain antibody (biotin)</p>

<p>Purified Goat anti-human Eotaxin polyclonal antibody</p>

<p>Rabbit polyclonal PSME2 antibody (biotin)</p>

<p>GPR37L1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>Neuroplastin antibody was raised using the middle region of NPTN corresponding to a region with amino acids MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN</p>

<p>Goat anti-mouse IgG (H+L) (Poly-HRP40) was raised in goat using rabbit IgG as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HBS1L antibody, catalog no. 70R-1943</p>

<p>Mouse monoclonal CISD1 antibody</p>

<p>The CREB antibody is a highly specialized antibody used in life sciences research. It is commonly used to study the function and regulation of CREB (cAMP response element-binding protein), a transcription factor involved in various cellular processes. This polyclonal antibody specifically targets and binds to CREB, allowing researchers to investigate its role in signal transduction, gene expression, and cell signaling pathways.</p>

<p>CREB1 antibody was raised in Rabbit using Human CREB1 as the immunogen</p>

<p>This antibody reacts with heavy chains on human IgM (mu chain).</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RSBN1 antibody, catalog no. 70R-3989</p>

<p>MINA53 antibody is a monoclonal antibody that specifically targets the MINA53 protein. It has been widely used in Life Sciences research for various applications, including Western blotting, immunohistochemistry, and flow cytometry. The MINA53 protein is involved in multiple cellular processes, such as cell proliferation and differentiation. This antibody binds to MINA53 with high specificity and affinity, making it an excellent tool for studying its function and regulation. Additionally, the MINA53 antibody can be conjugated with different labels or used in combination with other antibodies for multiplex assays. Its versatility and reliability make it an essential reagent for researchers working in the field of oncology, immunology, or molecular biology.</p>

<p>Rabbit polyclonal SLC38A3 antibody</p>

<p>Mouse monoclonal TCP11L2 antibody</p>

<p>Rabbit polyclonal ERN2 antibody</p>

<p>ARL3 antibody was raised in rabbit using the N terminal of ARL3 as the immunogen</p>

<p>Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its potency has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes.</p>

<p>FLJ25439 antibody was raised using the N terminal Of Flj25439 corresponding to a region with amino acids MQASPIRIPTVSNDIDWDFCFHMSQQTEIPAHQQTDELYPTGGCGESEEE</p>

<p>The ID3 antibody is a highly specialized monoclonal antibody that targets a specific glycoprotein. This antibody is widely used in the field of life sciences for various applications. It has been extensively studied and proven to have high specificity and affinity for its target.</p>

<p>MND1 antibody was raised in Rabbit using Human MND1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MOV10L1 antibody, catalog no. 70R-4743</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C14orf48 antibody, catalog no. 70R-9334</p>

<p>Purified recombinant MYOZ1 protein (His tag)</p>

<p>LIPA antibody was raised in Rabbit using Human LIPA as the immunogen</p>

<p>AHSG antibody is a monoclonal antibody that targets alpha-2-HS-glycoprotein (AHSG), a growth factor involved in various biological processes. It has been shown to have neutralizing effects on the activity of AHSG, making it a potential therapeutic option for conditions where AHSG overactivity is implicated.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Its effectiveness has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Notably, it also binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALDOB antibody, catalog no. 70R-2209</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC43A2 antibody, catalog no. 70R-6270</p>

<p>Purified recombinant Human ABHD10 Protein (His tag)</p>

<p>GABRA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids WAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGL</p>

<p>Goat anti-armenian hamster IgG (H + L) (biotin) was raised in goat using hamster IgG (H &amp; L) as the immunogen.</p>

<p>Mouse monoclonal NUBPL antibody</p>

<p>Gamma Globulin protein is a versatile and essential component of the immune system. It plays a crucial role in protecting the body against infections and diseases. This protein is involved in various biological processes, including adrenomedullin regulation, growth factor signaling, and antigen presentation.</p>

<p>Purified Rabbit polyclonal MRPS33 antibody</p>

<p>Luteinizing hormone beta antibody (HRP) was raised in mouse using human LH beta subunit as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSMB6 antibody, catalog no. 70R-3524</p>

<p>Rabbit polyclonal SPANXE antibody</p>

<p>Fibrinogen antibody is a growth factor that belongs to the class of monoclonal antibodies. It targets chemokines, glycoproteins, and lipoprotein lipase to regulate endothelial growth. This medicament works by binding to fibrinogen, preventing its activation and subsequent clot formation. Fibrinogen antibody can be used as a therapeutic agent in various life sciences applications, including DNA vaccines and isolated nucleic acid research. With its high specificity and affinity, this monoclonal antibody offers a valuable tool for studying activated pathways in biological systems.</p>

<p>Dopamine receptor 2 antibody was raised in rabbit using a 13 amino acid peptide of rat D1R as the immunogen.</p>

<p>The GRP78 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the GRP78 protein, which is found in adipose tissues. This antibody has been proven effective in inhibiting the activity of phorbol, a compound that promotes cell growth and division. Additionally, it acts as a potent cdk4/6 inhibitor, preventing the progression of cell cycle and reducing the risk of abnormal cell growth.</p>

<p>TTC19 antibody was raised in rabbit using the N terminal of TTC19 as the immunogen</p>

<p>Purified recombinant Human LCAT protein (His tag)</p>

<p>The alpha Tubulin antibody is a highly specialized product used in Life Sciences research. It is designed to detect and target alpha-tubulin, a protein that plays a crucial role in cell division and structure. This antibody has been extensively tested and proven to be effective in various applications.</p>

<p>Inactivated Streptococcus Group B bacterial cell suspension</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HMG1L10 antibody, catalog no. 20R-1115</p>

<p>TCP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids CVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF420 antibody, catalog no. 70R-4414</p>

<p>HPRT1 antibody was raised in Rabbit using Human HPRT1 as the immunogen</p>

<p>ZDHHC17 antibody was raised using the middle region of ZDHHC17 corresponding to a region with amino acids LFYNFGKSWKSDPGIIKATEEQKKKTIVELAETGSLDLSIFCSTCLIRKP</p>

<p>KCNK13 antibody was raised using the C terminal of KCNK13 corresponding to a region with amino acids GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA</p>

<p>ETS1 antibody was raised in Mouse using a purified recombinant fragment of human ETS1 expressed in E. coli as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CDKN2AIP antibody, catalog no. 70R-4954</p>

<p>C21ORF91 antibody was raised using the middle region of C21Orf91 corresponding to a region with amino acids LCRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHYSREELNSMTLGEVE</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug effectively inhibits bacterial growth, preventing transcription and replication. Its high efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, such as hydrolysis, oxidation, reduction, or conjugation, this drug exhibits its effectiveness against Mycobacterium tuberculosis strains by binding to specific markers expressed at high levels. Experience the potent action of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside and witness its ability to inhibit cell growth in culture.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PHF11 antibody, catalog no. 70R-8057</p>

<p>The NSE antibody is a high polymer mouse monoclonal antibody that is widely used in Life Sciences research. It is specifically designed for the detection and analysis of NSE (Neuron-Specific Enolase) protein. The NSE antibody can be used in various applications, including immunocytochemical methods, mass spectrometry, chemiluminescence assays, and particle-based reactions.</p>

<p>IL24 antibody was raised in Rabbit using Human IL24 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C7orf43 antibody, catalog no. 70R-3224</p>

<p>Mouse monoclonal PLEKHA3 antibody</p>

<p>Purified Polyclonal PIGW antibody</p>

<p>Histone H3 Monoclonal Antibody BSA/Azide Free</p>

<p>The p53 antibody is an essential tool for researchers in the field of life sciences. It is a highly specific antibody that targets the phosphatase protein p53. This protein plays a crucial role in regulating cell growth and preventing tumor formation. The p53 antibody can be used to study various cellular processes, including apoptosis, DNA repair, and cell cycle arrest.</p>

<p>NARG1L antibody was raised in Rabbit using Human NARG1L as the immunogen</p>

<p>Rabbit polyclonal WRKY68 antibody</p>

<p>Rabbit polyclonal SMARCD2 antibody</p>

<p>Purified Polyclonal CaMK2 beta antibody</p>

<p>ZNF486 antibody was raised in rabbit using the middle region of ZNF486 as the immunogen</p>

<p>Rabbit polyclonal RPL38 antibody (FITC)</p>

<p>The PAK2 antibody is a mouse monoclonal antibody that targets the hepatocyte growth factor (HGF). HGF is a potent biological growth factor that plays a crucial role in cell proliferation, differentiation, and survival. The PAK2 antibody specifically binds to HGF and inhibits its biological effects, including cell proliferation and migration.</p>

<p>Rabbit polyclonal PKC theta antibody (Ser645)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CCR5 antibody, catalog no. 70R-7848</p>

<p>Purified Polyclonal SAP14 antibody</p>

<p>Sheep polyclonal 17b Boldenone antibody</p>

<p>FkBP4 antibody was raised in mouse using recombinant human FkBP4 (1-459aa) purified from E. coli as the immunogen.</p>

<p>Purified native Ovotransferrin protein (Chicken)</p>

<p>Purified Polyclonal ADH7 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RHBG antibody, catalog no. 70R-7321</p>

<p>Rabbit polyclonal Synaptotagmin antibody (Ser309)</p>

<p>GHR protein is a monoclonal antibody that belongs to the group of Conjugated Proteins. It has various biological effects and is widely used in the field of Life Sciences. GHR protein has shown significant activity in 3T3-L1 preadipocytes, where it affects nuclear extracts and regulates the expression of certain proteins and antigens. This protein can also be used as a diagnostic reagent due to its ability to bind specifically to certain growth factors. Additionally, GHR protein has been studied extensively using molecular docking techniques, which have revealed its binding affinity to nucleotide bases. Furthermore, acid-induced inhibition assays have demonstrated the acid labile nature of this protein.</p>

<p>GSTP1 antibody was raised using the N terminal of GSTP1 corresponding to a region with amino acids TVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQ</p>