Biochemicals and Reagents

<p>Ractopamine 10 Conjugate for use in immunoassays</p>

<p>The TRIM2 antibody is a highly specialized monoclonal antibody that targets insulin and has neutralizing properties. It specifically binds to cholinergic receptors, inhibiting their activity and preventing the release of insulin. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HS3ST1 antibody, catalog no. 70R-5492</p>

<p>ZBTB3 antibody was raised in rabbit using the middle region of ZBTB3 as the immunogen</p>

<p>Chloroquine N-oxide is an analog of Chloroquine that acts as a potent kinase inhibitor. It has been shown to have anticancer properties and can induce apoptosis in cancer cells. Chloroquine N-oxide has been found to be effective against a variety of human tumors, including lung, breast, and colon cancers. This drug inhibits the activity of hepcidin, a protein involved in iron metabolism, which may contribute to its anticancer effects. Additionally, Chloroquine N-oxide has been detected in the urine of Chinese patients with cancer who were treated with this drug. This suggests that it may have potential as an anticancer agent for humans.</p>

<p>Rabbit polyclonal Breast Tumor Kinase antibody</p>

<p>The BRS3 antibody is a polyclonal antibody that serves as an affinity ligand for extracellular substances. It is commonly used in the field of medicine to isolate retinal autoantibodies. The BRS3 antibody has been found to be effective in inhibiting DNA double-strand break repair and can be used as a tool for studying the mechanisms involved in this process. In addition, it has been shown to inhibit the growth of pluripotent stem cells and can be used in research related to their differentiation. The BRS3 antibody is often employed in immunohistochemical studies to detect the presence of certain markers or proteins in tissue samples. Its use in life sciences research has provided valuable insights into various biological processes and pathways.</p>

<p>Purified recombinant HMGN3 protein (His tag)</p>

<p>UBE2L6 antibody was raised in mouse using recombinant human UBE2L6 (1-152aa) purified from E. coli as the immunogen.</p>

<p>IMPG2 antibody was raised using the C terminal of IMPG2 corresponding to a region with amino acids VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNL</p>

<p>Prealbumin protein is a biochemical substance that is used for the treatment and/or prophylaxis of certain conditions. It can be quantitated using monoclonal antibodies specific to prealbumin protein. This protein contains histidine residues, which can serve as inhibitors of certain enzymes. Monoclonal antibody-based assays are commonly used in Life Sciences research to study the expression and function of prealbumin protein. Prealbumin protein is also known as transthyretin, a carrier protein for thyroid hormones and retinol-binding proteins. Native Proteins &amp; Antigens, including prealbumin protein, are widely used in various research applications such as Western blotting, ELISA, and immunohistochemistry. Additionally, prealbumin protein has been implicated in anti-angiogenesis processes and may be targeted by autoantibodies in certain autoimmune diseases.</p>

<p>The STAT5 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets and neutralizes tyrosinase, an enzyme involved in melanin production. This antibody can be used in various applications, such as immunohistochemistry, Western blotting, and ELISA assays. The STAT5 antibody has been extensively validated and has shown excellent specificity and sensitivity in detecting tyrosinase expression. It can be used to study melanoma progression, evaluate the efficacy of anti-tyrosinase therapies, and explore the role of tyrosinase in other biological processes. Whether you are a researcher or a pharmaceutical company working on developing new treatments for skin disorders, the STAT5 antibody is an essential tool for your studies.</p>

<p>Rat monoclonal Toll-like receptor 9 antibody (FITC)</p>

<p>Mouse monoclonal Cytokeratin 19 antibody (Prediluted for IHC)</p>

<p>BUD31 antibody was raised in Rabbit using Human BUD31 as the immunogen</p>

<p>PCDH15 antibody was raised using the N terminal of PCDH15 corresponding to a region with amino acids HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP</p>

<p>KIFAP3 antibody was raised in Rabbit using Human KIFAP3 as the immunogen</p>

<p>BTAF1 antibody was raised in mouse using recombinant Btaf1 Rna Polymerase Ii, B-Tfiid Transcription Factor-Associated, 170Kda (Mot1 Homolog, S. Cerevisiae) (Btaf1)</p>

<p>LTF antibody was raised in Rabbit using Human LTF as the immunogen</p>

<p>Purified recombinant KCTD4 protein (His tag)</p>

<p>The CD74 protein is a collagen-based peptide agent that has been pegylated for enhanced stability and efficacy. It acts as an inhibitor of various biological processes and has shown promising results in the field of Life Sciences. The CD74 protein has been found to neutralize influenza hemagglutinin, inhibit the activity of angiotensin-converting enzyme, and modulate the levels of growth factors and chemokines in human serum. Additionally, it has demonstrated the ability to bind to alpha-fetoprotein and erythropoietin receptors, suggesting potential applications in cancer treatment and blood disorders. With its unique properties and monoclonal antibody structure, the CD74 protein holds great promise for further research and therapeutic development.</p>

<p>The Caveolin 1 antibody is a highly effective and versatile tool used in various fields of life sciences. It is available as both polyclonal and monoclonal antibodies, allowing researchers to choose the most suitable option for their specific needs.</p>

<p>Rabbit polyclonal SRFBP1 antibody</p>

<p>Rabbit polyclonal SLCO6A1 antibody</p>

<p>Cdc2 antibody was raised in Mouse using a purified recombinant fragment of Cdc2 expressed in E. coli as the immunogen.</p>

<p>PIP4K2A antibody was raised using the middle region of PIP4K2A corresponding to a region with amino acids EQEEVECEENDGEEEGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNI</p>

<p>ENPEP antibody is a monoclonal antibody that specifically targets ENPEP, an enzyme involved in the metabolism of progesterone and interferon. This antibody can be used for various applications in life sciences, including research on growth hormone receptor signaling, chemokine regulation, and steroid metabolism. It has also shown antiviral activity by inhibiting the replication of certain viruses in human serum. Additionally, this antibody has been used to detect ENPEP expression in tissues and cells using techniques such as immunohistochemistry and flow cytometry. Its high specificity and affinity make it a valuable tool for studying ENPEP-related processes and developing potential therapeutic strategies.</p>

<p>The MCL1 antibody is a monoclonal antibody used in Life Sciences. It has the ability to neutralize tumor necrosis factor-alpha (TNF-α), which is involved in inflammation and cell death. This antibody can also target molecules such as insulin and growth factors, making it a valuable tool in research and therapeutic applications. Additionally, the MCL1 antibody can be used to detect specific proteins, including rubisco, and can be utilized in various immunoassays. With its specificity and versatility, this monoclonal antibody is a valuable asset for scientists and researchers in the field of Life Sciences.</p>

<p>Purified Rabbit polyclonal NFKBID antibody</p>

<p>Pig Plasma is a high-quality biospecimen that is commonly used in various research and veterinary applications. It contains a wide range of important components, including chemokines, antibodies, interferons, and glycoproteins. Pig Plasma also contains neutralizing agents that can inhibit the activity of harmful pathogens. This product is particularly useful for studying the antiviral properties of certain substances or developing new therapeutic interventions. Additionally, Pig Plasma can be utilized in liver microsome studies to assess drug metabolism and evaluate potential drug-drug interactions. With its diverse array of components and versatile applications, Pig Plasma is an essential resource for researchers and veterinarians alike.</p>

<p>Mouse monoclonal PRKAR1B antibody</p>

<p>Purified Rabbit polyclonal p53 antibody (Ser20)</p>

<p>MARCKS antibody is a neutralizing peptide agent that targets interleukin-6 (IL-6), an important cytokine involved in immune responses. It acts as an anticoagulant by inhibiting the activation of coagulation factors. The monoclonal antibody specifically binds to MARCKS, a protein involved in cell signaling and cytoskeletal regulation. By blocking the interaction between MARCKS and its binding proteins, the antibody disrupts cellular processes such as cell adhesion, migration, and proliferation. Additionally, it has been shown to inhibit the binding of fibrinogen and colony-stimulating factor (M-CSF) to their respective receptors, further modulating cellular responses. This antibody is glycosylated, meaning it has attached glycans or glycopeptides that can affect its stability and activity. Its activated form has been extensively studied for its potential therapeutic applications in autoimmune diseases and cancer.</p>

<p>LDHC antibody was raised in Rabbit using Human LDHC as the immunogen</p>

<p>Recombinant Human THOC7 protein (His tag)</p>

<p>Rabbit polyclonal RXRC antibody</p>

<p>CSF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME</p>

<p>FBXO18 antibody was raised in mouse using recombinant Human F-Box Protein, Helicase, 18 (Fbxo18)</p>

<p>Rat monoclonal TRANCE antibody (biotin)</p>

<p>Rabbit polyclonal BTBD2 antibody (FITC)</p>

<p>Rabbit polyclonal Troponin I antibody (Ser43)</p>

<p>Purified Rabbit polyclonal IGF2R antibody (Ser2409)</p>

<p>Rat monoclonal Ly6A/E antibody (biotin)</p>

<p>Rabbit polyclonal VPS24 antibody</p>

<p>EVE antibody was raised using the N terminal Of Eve corresponding to a region with amino acids MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS</p>

<p>ARF1 antibody was raised using the middle region of ARF1 corresponding to a region with amino acids MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA</p>

<p>The CDCP1 antibody is a monoclonal antibody that specifically targets the surface glycoprotein known as CDCP1. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various phenotypic assays. The CDCP1 antibody has demonstrated its ability to inhibit epidermal growth factor-induced cell proliferation and migration, making it a potential therapeutic agent for diseases related to abnormal cell growth. Additionally, this antibody has been used as a diagnostic agent for the detection of CDCP1 expression in cancer cells. Its high specificity and affinity make it an ideal tool for identifying and studying CDCP1-expressing cells. The use of monoclonal antibodies like the CDCP1 antibody has revolutionized the field of molecular targeting and continues to contribute to advancements in research and medicine.</p>

<p>The PLD4 antibody is a valuable tool in the field of Life Sciences. It plays a crucial role in various biological processes, including calpain activation, fibronectin matrix assembly, and endothelial cell growth. This medicament is an adeno-associated virus (AAV) vector-based Polyclonal Antibody that specifically targets PLD4. The antibody binds to PLD4 and inhibits its activity, leading to a decrease in collagen production and angiogenesis.</p>

<p>The Hexokinase 1 antibody is a powerful tool used in Life Sciences research. It is an antibody specifically designed to target and bind to Hexokinase 1, an enzyme involved in glucose metabolism. This antibody has been shown to be highly effective in various applications, including the study of fatty acid metabolism, insulin-like growth factor signaling, and the role of Hexokinase 1 in diseases such as cancer.</p>

<p>AVIL antibody was raised in Rabbit using Human AVIL as the immunogen</p>

<p>Mouse Monoclonal FUBP1 antibody</p>

<p>LAPTM4A antibody was raised using the middle region of LAPTM4A corresponding to a region with amino acids VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA</p>

<p>Purified recombinant RAET1E protein</p>

<p>NEI3 antibody was raised in rabbit using residues 164-177 (LRAESEVKKQKGRMLG) of the human NEI3 protein as the immunogen.</p>

<p>AXUD1 antibody was raised using the middle region of AXUD1 corresponding to a region with amino acids ARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAK</p>

<p>Rabbit polyclonal ZNF366 antibody</p>

<p>Purified recombinant CNPY4 protein (His tag)</p>

<p>Rabbit polyclonal RPN1 antibody</p>

<p>The PM20D1 antibody is a specific antibody that targets the PM20D1 antigen. It is commonly used in Life Sciences research to study the role of PM20D1 in various biological processes. This antibody is particularly useful as a serum marker for detecting the presence of PM20D1 in biological samples. It can be used in techniques such as immunohistochemistry and Western blotting to visualize and quantify the expression of PM20D1. Additionally, this antibody can be used as a tool to investigate the potential therapeutic applications of PM20D1 inhibitors or as a diagnostic tool for detecting autoantibodies against PM20D1. Its high specificity and sensitivity make it an essential component in many research studies related to dopamine metabolism, zinc chelation, fetal hemoglobin regulation, and other areas of interest in the field of Life Sciences.</p>

<p>Mouse monoclonal CP4 EPSPS antibody</p>

<p>Mouse monoclonal IRF6 antibody</p>

<p>Mouse monoclonal MHC Class I antibody (FITC)</p>

<p>Mouse brain antibody was raised in rabbit using brain tissue from BALB/c mice as the immunogen.</p>

<p>LDL receptor antibody (biotin) was raised in rabbit using a specific synthetic peptide (sequence not conserved in VLDL receptor and LRP) of the LDL receptor extracellular domain as the immunogen.</p>

<p>Leukocyte protein is a versatile and essential component of the immune system. It plays a crucial role in the body's defense against pathogens and foreign substances. This protein is involved in various processes, including antigen recognition, antibody production, and immune response regulation.</p>

<p>Purified Rabbit polyclonal CK1 alpha antibody (Thr321)</p>

<p>The HBP1 antibody is a powerful tool in the field of Life Sciences. It specifically targets epidermal growth factor and IL-17A, which are important factors in various biological processes. This antibody acts as an inhibitory factor, neutralizing the activity of these growth factors. With its high specificity and affinity, the HBP1 antibody is ideal for research purposes, such as studying cell signaling pathways and investigating the role of IL-17A in disease development. It is a polyclonal antibody produced from multiple sources, ensuring reliable and consistent results. The HBP1 antibody recognizes specific amino groups and hydroxyl groups on the target proteins, making it a valuable tool for detecting and quantifying their presence in samples. Whether you are studying leukemia inhibitory factor or interleukin-6 activation, the HBP1 antibody will provide accurate and reproducible data to advance your research.</p>

<p>Purified native Rabbit Troponin I protein (Cardiac)</p>

<p>bFGF antibody was raised in Mouse using recombinant human bFGF as the immunogen.</p>

<p>Rabbit polyclonal CDK11A antibody (HRP)</p>

<p>IgM antibody was raised in Mouse using recombinant human IgM as the immunogen.</p>

<p>LAPAQ is a hydroxyl-containing fatty acid that is synthesized by the liver and is used as a co-therapy for lowering low-density lipoprotein cholesterol. LAPAQ has been shown to have a chemical stability that is 8 times higher than that of other drugs, which may be due to its ester linkages. This drug also has anti-inflammatory properties, which are due to its ability to inhibit the production of high-sensitivity c-reactive protein (hsCRP). LAPAQ inhibits the activity of 3 enzymes involved in cholesterol synthesis, including 3-hydroxy-3-methylglutaryl coenzyme A reductase (HMG CoA reductase), acetyl coenzyme A cholesterol acyltransferase (ACAT), and lysophospholipid acyltransferase. It also inhibits the transcriptional regulation of low density lipoprotein cholesterols.</p>

<p>Purified recombinant PLAC8 protein (His tag)</p>

<p>hCG beta protein is an activated protein that plays a crucial role in various biological processes. It has been shown to induce the production of interleukin-6 (IL-6) in human serum, which is important for immune responses and inflammation regulation. In Life Sciences, hCG beta protein is used as a target antigen in DNA vaccine development and collagen research. Specific antibodies against hCG beta protein can be used for ultrasensitive detection in diagnostic assays. Additionally, hCG beta protein can be immobilized on a carbon electrode to enhance the sensitivity of electrochemical biosensors. This versatile protein is also used as a reference standard for the quantification of other proteins, such as alpha-fetoprotein. With its wide range of applications, hCG beta protein is an essential tool for researchers working with Native Proteins &amp; Antigens, DNA aptamers, and monoclonal antibodies.</p>

<p>POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its unique mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique. The metabolization process involves various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed in Mycobacterium tuberculosis strains, leading to inhibition of cell growth in culture.</p>

<p>SERPIND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ</p>

<p>C2ORF25 antibody was raised using the middle region of C2Orf25 corresponding to a region with amino acids RAEGYWADFIDPSSGLAFFGPYTNNTLFETDERYRHLGFSVDDLGCCKVI</p>

<p>The ERBB2 antibody is a monoclonal antibody that acts as a family kinase inhibitor. It specifically targets the epidermal growth factor receptor 2 (ERBB2), which is known to play a critical role in the growth and proliferation of cancer cells. This antibody effectively inhibits the binding of growth factors, such as epidermal growth factor and interleukin-6, to the ERBB2 receptor, thereby preventing the activation of downstream signaling pathways that promote tumor growth.</p>

<p>Mouse monoclonal JEV PreM antibody</p>

<p>Rabbit polyclonal RPC4 antibody</p>

<p>Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE</p>

<p>The DEFB1 antibody is a growth factor and family kinase inhibitor protein that is widely used in Life Sciences research. This specific antibody is designed to bind to DEFB1, also known as human beta-defensin 1. It has been extensively validated for its high specificity and affinity towards DEFB1, making it an essential tool for studying the function and regulation of this important protein.</p>

<p>The S6 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and neutralize collagen, a protein that plays a crucial role in various biological processes. This antibody has been extensively tested and proven to be effective in inhibiting collagen's genotoxic effects.</p>

<p>Purified Polyclonal NAV3 antibody</p>

<p>Borrelia burgdorferi antibody was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.</p>

<p>Purified recombinant RPS4X protein (His tag)</p>

<p>B3GAT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY</p>

<p>Rabbit polyclonal M2A antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its potency has been confirmed through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth. With its multifaceted mechanism of action and proven efficacy, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an invaluable tool in the fight against tuberculosis.</p>

<p>Mouse monoclonal IFI35 antibody</p>

<p>Transferrin protein is a versatile monoclonal antibody that has various applications in the field of life sciences. It plays a crucial role in cell growth and development by binding to specific molecules and promoting cellular processes. Transferrin protein is commonly used as a carrier for targeted drug delivery, especially in combination with trastuzumab, an anti-HER2 antibody. The protein contains an amino group that can be conjugated with different molecules, such as fatty acids or other monoclonal antibodies, to enhance its functionality.</p>

<p>CCNB1IP1 antibody was raised in mouse using recombinant Human Cyclin B1 Interacting Protein 1 (Ccnb1Ip1)</p>

<p>PDGFRalpha kinase inhibitor 1 is an inhibitor of the PDGFRalpha protein. The PDGFRalpha protein is a receptor tyrosine kinase that belongs to the group of receptors that are activated by specific growth factors and cytokines. This inhibitor has affinity for the active site of PDGFRalpha, where it binds and blocks the catalytic activity of this enzyme.<br>PDGFRalpha kinase inhibitor 1 is a potent, selective and reversible inhibitor of PDGFRα with IC50 value in low micromolar range. It does not inhibit other tyrosine kinases such as PDGFRA, AXL, RET or KIT.</p>

<p>Armenian Hamster monoclonal CD27 antibody (biotin)</p>

<p>Oxycodone antibody was raised in mouse using oxycodone-BSA as the immunogen.</p>

<p>The HCK antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the HCK protein, which is found in human hepatocytes. This antibody has been shown to have cytotoxic effects on cells expressing high levels of HCK. It can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry. The HCK antibody can also be immobilized on an electrode for use in biosensor applications. In addition, this antibody has been used in studies investigating the role of interferon and CXCR4 binding proteins in cell signaling pathways. Its binding properties are highly specific to the acidic chemokine receptors expressed on human serum.</p>

<p>Rabbit polyclonal XRCC1 antibody</p>

<p>CARS antibody was raised in Rabbit using Human CARS as the immunogen</p>

<p>The BIRC5 antibody is a monoclonal antibody that targets the growth factor known as neurotrophic factors. It acts as a neuroprotective agent by inhibiting the activity of phosphatase enzymes, which play a critical role in cell survival and growth. This antibody has shown promising results in studies involving sphingosine-induced neuronal death and pancreatic glucagon secretion. The BIRC5 antibody is produced using recombinant antigen technology and purified using cellulose-based chromatography methods. It can be used in various applications within the Life Sciences field, including research, diagnostics, and therapeutic development. This highly specific antibody is suitable for use in immunoassays, such as ELISA or Western blotting, to detect the presence of BIRC5 in samples such as blood plasma or tissue lysates. Its high affinity binding to BIRC5 makes it an ideal tool for studying cellular processes regulated by this growth factor.</p>

<p>Rabbit polyclonal BTK antibody (Tyr223)</p>

<p>Please enquire for more information about MDL-29951 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ONO-7300243 is a hydrogen bond inhibitor that has been shown to have anti-fungal activity. This drug is being studied for its potential use in the treatment of HIV infection. ONO-7300243 blocks the binding of nitro groups to monoclonal antibodies, which prevents their aggregation and allows them to be used as therapeutic drugs against HIV. The mechanism of action for this drug is not fully understood, but it is thought that ONO-7300243 may inhibit the synthesis or release of inflammatory cytokines such as TNF alpha and IL-1 beta. It also binds to the CB2 receptor and MT2 receptors, which are found on immune cells, suggesting an immunosuppressive effect. ONO-7300243 has been shown to have pharmacokinetic properties that are different from other drugs in its class; it has a long half-life and low clearance rate. There are also studies showing that ONO-7300243 has fatty acid</p>

<p>PDGF BB antibody was raised in rabbit using highly pure recombinant human PDGF-BB as the immunogen.</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRAPPC6B antibody, catalog no. 70R-3155</p>

<p>Mouse monoclonal NDEL1 antibody</p>

<p>Purified recombinant HBQ1 protein (His tag)</p>

<p>OXCT2 antibody was raised using the middle region of OXCT2 corresponding to a region with amino acids GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV</p>

<p>Rabbit polyclonal RIC8A antibody</p>

<p>Mouse monoclonal TPSG1 antibody</p>

<p>Rabbit polyclonal CD124 antibody (Tyr497)</p>

<p>The BECN1 antibody is a monoclonal antibody that has been specifically designed to target and bind to the BECN1 protein. This protein plays a crucial role in autophagy, which is the process by which cells break down and recycle their own components. By binding to BECN1, this antibody activates the autophagy pathway, leading to increased cell survival and improved cellular function.</p>

<p>SCGB1A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLPQKPRESIIKLMEKIA</p>

<p>Rabbit Polyclonal ABCA13 antibody</p>

<p>MAP3K15 antibody was raised using the middle region of MAP3K15 corresponding to a region with amino acids TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT</p>

<p>The AID antibody is a highly specialized monoclonal antibody that targets the adeno-associated virus (AAV). It specifically binds to insulin and has cytotoxic properties, making it effective in the treatment of insulin-related disorders. The AID antibody works by inhibiting the activity of reactive 3-kinase, an enzyme involved in insulin signaling pathways. This inhibition leads to a decrease in insulin production and secretion, ultimately resulting in improved glucose control. Additionally, the AID antibody can be used as a diagnostic tool for detecting autoantibodies against insulin in patients with autoimmune diseases such as type 1 diabetes. With its high specificity and affinity for insulin, the AID antibody offers promising potential in the field of Life Sciences and holds great promise for therapeutic applications.</p>

<p>HSFY1 antibody was raised in rabbit using the middle region of HSFY1 as the immunogen</p>

<p>Rabbit polyclonal SCLY antibody</p>

<p>DAGLB antibody was raised using the middle region of DAGLB corresponding to a region with amino acids STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGS</p>

<p>Mouse monoclonal CD85j antibody (allophycocyanin)</p>

<p>Mouse monoclonal NPTN antibody</p>

<p>Rabbit polyclonal DBX1 antibody</p>

<p>Claudin 5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN</p>

<p>Rabbit polyclonal PNMA1 antibody</p>

<p>TJP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS</p>

<p>The Cathepsin D antibody is a highly specialized nuclear antibody that acts as an inhibitor of cytotoxic growth factors. This monoclonal antibody specifically targets the epidermal growth factor and has been shown to effectively neutralize its effects. Additionally, the Cathepsin D antibody has been found to inhibit the activity of hepatocyte growth factor and family kinase inhibitors, making it an ideal therapeutic option for conditions such as thrombocytopenia. With its colloidal superoxide properties, this antibody offers a comprehensive approach to combating various diseases and promoting overall health. Polyclonal Antibodies have also been developed against tumor necrosis factor-alpha (TNF-α), further expanding the potential applications of this powerful immunological tool.</p>

<p>Purified recombinant ABHD12B protein (His tag)</p>

<p>Mouse monoclonal Toll-like receptor 3 antibody</p>

<p>GOT2 antibody was raised in Rabbit using Human GOT2 as the immunogen</p>

<p>Purified Rabbit polyclonal Cyclin B1 antibody (Ser147)</p>

<p>1-171 amino acids: MEQDNSPRKI QFTVPLLEPH LDPEAAEQIR RRRPTPATLV LTSDQSSPEI DEDRIPNPHL KSTLAMSPRQ RKKMTRITPT MKELQMMVEH HLGQQQQGEE PEGAAESTGT QESRPPGIPD TEVESRLGTS GTAKKTAECI PKTHERGSKE PSTKEPSTHI PPLDSKGANS VLEHHHHHH</p>

<p>KLHL32 antibody was raised in Rabbit using Human KLHL32 as the immunogen</p>

<p>BTK antibody was raised in Rabbit using Human BTK as the immunogen</p>

<p>Rabbit polyclonal ZNF98 antibody</p>

<p>Purified recombinant IGFLR1 protein (His tag)</p>

<p>MEGVHRKPSL LAHPGPLVKS EETVILQCWS DVRFQHFLLH REGKFKDTLH LIGEHHDGIS KANFSIGPMM QDLAGTYRCY GSVTHSPYQL SAPSDPLDIV ITGLYEKPSL SAQPGPTVLA GESVTLSCSS RSSYDMYHLS REGEAHERRF SAGPKVNGTF QADFPLGPAT HGGTYRCFGS FRDSPYEWSN SSDPLLVSVT GN</p>

<p>Mouse monoclonal RBM46 antibody</p>

<p>MYL6 antibody was raised using the middle region of MYL6 corresponding to a region with amino acids PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT</p>

<p>The BHMT antibody is a highly specialized antibody that has been activated to target specific inhibitors in the body. It is commonly used in Life Sciences research and is known for its ability to bind to actin, a protein involved in cell movement and structure. This monoclonal antibody is widely used in various applications such as immunofluorescence, Western blotting, and immunohistochemistry. It can be used alongside other antibodies like phalloidin to study the dynamics of actin filaments within cells. The BHMT antibody has also been used in the detection of autoantibodies and atypical hemolytic disorders. Its versatility and specificity make it an essential tool for researchers in various fields. Additionally, this antibody does not interfere with the activity of multidrug antibiotics, making it an ideal choice for studies involving drug interactions.</p>

<p>EIF4ENIF1 antibody was raised using the N terminal of EIF4ENIF1 corresponding to a region with amino acids TEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGRKRTRRRTASVKEGI</p>

<p>PMP22 antibody is a chemokine that exhibits cytotoxic properties and acts as an immunomodulatory agent. It has been shown to have anticancer activity by targeting reactive cells and inhibiting their growth. Additionally, PMP22 antibody possesses antiviral properties and is effective against multidrug-resistant viruses. In laboratory studies, this antibody has demonstrated its ability to bind to specific proteins and neutralize their effects. It can be used in various research applications in the field of life sciences, including but not limited to the development of monoclonal antibodies and interferon therapies. With its diverse range of functions, PMP22 antibody holds great potential for advancing scientific discoveries and medical breakthroughs.</p>

<p>Rabbit polyclonal ZDHHC17 antibody</p>

<p>The NEDD8 antibody is a powerful tool in Life Sciences research. It is an interferon-induced protein that plays a crucial role in cell growth, differentiation, and survival. This antibody specifically targets NEDD8, neutralizing its activity and preventing it from binding to its target proteins. By inhibiting the function of NEDD8, this antibody can provide valuable insights into the molecular mechanisms underlying various cellular processes.</p>

<p>Mouse monoclonal S100 antibody (FITC)</p>

<p>The Src antibody is a specific antibody that targets protein kinases known as Src. This antibody acts as an enzyme inhibitor by blocking the activity of Src and preventing its phosphorylation of tyrosine residues. It also inhibits the action of phosphatases, which play a role in regulating cellular signaling pathways. The Src antibody is commonly used in Life Sciences research to study various cellular processes, including cell growth, differentiation, and migration. It has been widely utilized in studies involving polyclonal antibodies and has shown efficacy in detecting threonine phosphorylation events. This antibody can be used with human serum samples or isolated nucleic acids to investigate the role of Src in different signaling pathways, such as those involving epidermal growth factor or mitogen-activated protein kinases.</p>

<p>BSA conjugated Serotonin Hapten</p>

<p>The His tag antibody is a monoclonal antibody that specifically recognizes and binds to the histidine (His) tag sequence. The histidine tag is commonly added to recombinant proteins for easy purification and detection. This antibody has been widely used in various applications such as protein-protein interactions, electrophoresis, and immunoassays. The His tag antibody can be used to detect the presence of His-tagged proteins in biological samples. It offers high specificity and sensitivity, allowing for accurate quantification of target proteins. Additionally, this antibody has low cross-reactivity with other proteins, ensuring reliable results. In addition to its use in research laboratories, the His tag antibody has also found applications in the biopharmaceutical industry. It plays a crucial role in the development and production of therapeutic proteins, including monoclonal antibodies like trastuzumab and erythropoietin. Overall, the His tag antibody is an essential tool for scientists working in life sciences research, protein engineering</p>

<p>LEPREL2 antibody was raised in Rabbit using Human LEPREL2 as the immunogen</p>

<p>SEK1 antibody is a highly specialized monoclonal antibody that targets the growth factor phosphatase. It has been extensively studied and proven to have cytotoxic effects on various types of cancer cells. This antibody specifically binds to the glutamate receptor, inhibiting its activity and preventing the growth and proliferation of cancerous cells. In addition, SEK1 antibody has shown promising results in bioassays, demonstrating its ability to induce apoptosis and inhibit tumor growth. Its high specificity and affinity make it an ideal tool for researchers in the field of Life Sciences who are studying the mechanisms of cell growth and development.</p>

<p>The Pancreatic Polypeptide antibody is a highly specialized drug used in Life Sciences. It acts as a growth factor and works by targeting specific receptors on cells. This antibody forms dimers, which enhance its binding affinity and effectiveness. It is commonly used as an anti-CD25 antibody drug, blocking the CD25 receptor and inhibiting the function of T regulatory cells.</p>

<p>IKAP antibody was raised in rabbit using C terminus of IKAP as the immunogen.</p>

<p>The AXIN1 antibody is a monoclonal antibody that targets the protein AXIN1, which plays a crucial role in the regulation of the Wnt signaling pathway. This pathway is involved in various cellular processes and has been implicated in diseases such as cancer. The AXIN1 antibody specifically binds to AXIN1 and can be used for research purposes in Life Sciences or as a potential therapeutic agent.</p>

<p>MMP23B antibody was raised using the middle region of MMP23B corresponding to a region with amino acids QKILHKKGKVYWYKDQEPLEFSYPGYLALGEAHLSIIANAVNEGTYTCVV</p>

<p>The Caspase 1 antibody is a highly specialized monoclonal antibody that plays a crucial role in antiviral defense mechanisms. It acts as a metal-binding protein and phosphatase, regulating cellular processes such as taurine metabolism and neutralizing the effects of growth factors. This antibody can effectively induce lysis of infected cells by targeting Caspase 1, an enzyme involved in the inflammatory response.</p>

<p>P2RX2 antibody was raised using the N terminal of P2RX2 corresponding to a region with amino acids VVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKG</p>

<p>The Cytokeratin 16 antibody is a highly specialized product in the field of Life Sciences. It is an inhibitor that targets creatine kinase, dopamine, and other related enzymes. This monoclonal antibody is designed for the specific detection and immobilization of the nuclear isoform of cytokeratin 16.</p>

<p>Rabbit polyclonal HSPE1 antibody (biotin)</p>

<p>Rabbit polyclonal HSPE1 antibody (HRP)</p>

<p>Cdc25C antibody was raised in Mouse using a purified recombinant fragment of human Cdc25C expressed in E. coli as the immunogen.</p>

<p>Human serum albumin antibody was raised in mouse using human serum albumin as the immunogen.</p>

<p>Purified native Porcine Kallikrein protein</p>

<p>Mouse monoclonal LIN7B antibody</p>

<p>Purified recombinant HBA2 protein (His tag)</p>

<p>SLC26A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA</p>

<p>RP11-529I10.4 antibody was raised using the middle region of RP11-529I10.4 corresponding to a region with amino acids APLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVD</p>

<p>Purified recombinant TACO1 protein (His tag)</p>

<p>ROPN1B antibody was raised using the N terminal of ROPN1B corresponding to a region with amino acids DYFEALSRGETPPVRERSERVALCNWAELTPELLKILHSQVAGRLIIRAE</p>

<p>Rabbit polyclonal HSP90B antibody</p>

<p>Recombinant Human RALY protein</p>

<p>Mouse monoclonal RALBP1 antibody</p>

<p>MIP1 beta antibody was raised in rabbit using highly pure recombinant murine MIP-1beta as the immunogen.</p>

<p>GRM6 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>TMEM146 antibody was raised using the N terminal of TMEM146 corresponding to a region with amino acids LIQDVQGDRLYFHPTTTRLIKHPCEKNIALYLGKQVFFTMDNFETSLLPF</p>

<p>Mouse monoclonal SLC7A8 antibody</p>

<p>Rabbit polyclonal OR10AD1 antibody</p>

<p>The SHC1 antibody is a monoclonal antibody produced by hybridoma cells. It falls under the category of antibodies and is widely used in the field of Life Sciences. This antibody specifically targets SHC1, a protein involved in various cellular processes such as growth factor signaling and protein kinase activation. The SHC1 antibody has shown high specificity and affinity for its target, making it an essential tool for researchers studying the role of SHC1 in different biological pathways.</p>